Sequence 1: | NP_729599.1 | Gene: | CG32055 / 39188 | FlyBaseID: | FBgn0052055 | Length: | 534 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_083249.1 | Gene: | Lrrc15 / 74488 | MGIID: | 1921738 | Length: | 579 | Species: | Mus musculus |
Alignment Length: | 402 | Identity: | 121/402 - (30%) |
---|---|---|---|
Similarity: | 181/402 - (45%) | Gaps: | 56/402 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 99 ALQKLNLTHAQLDELKSEQFPNPSEMINFDVSYNDILAITTKLMSGFGNLVYANFSENLIAVIEP 163
Fly 164 NAFRHMKNLRFLDLTTNYQENITL---GENANLRFLSISNNNLRDFQWCHLRVLPKLEELHLHSN 225
Fly 226 WLEHLDMGIFYALPNLRVLNVSNNNLFEIKRTLFMAPGEIAPLELLDYSSNIVKVLDDSVFCRLK 290
Fly 291 KLRTLNLWLNQINRIHPRAFLGLSSLQTLHLQGNKISILPDDVFANLTALEKLDLSKNNIQKLGL 355
Fly 356 RVFGE----------------------RILRKLIYLDLSNNYIADLHPLALSSMPFIKELRLRRN 398
Fly 399 RLVSLDLRMFAPLRQLQLLTINENRLEEIDGEILDTLDRLNHLELNNNRLTFLPDLKSSQNLLQL 463
Fly 464 RNITLEGNPWQC 475 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32055 | NP_729599.1 | leucine-rich repeat | 76..99 | CDD:275380 | 121/402 (30%) |
leucine-rich repeat | 100..123 | CDD:275380 | 10/22 (45%) | ||
LRR_8 | 128..180 | CDD:290566 | 11/51 (22%) | ||
leucine-rich repeat | 128..147 | CDD:275380 | 1/18 (6%) | ||
leucine-rich repeat | 148..171 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 172..192 | CDD:275380 | 6/22 (27%) | ||
LRR_RI | <187..400 | CDD:238064 | 70/237 (30%) | ||
LRR_8 | 192..251 | CDD:290566 | 23/58 (40%) | ||
leucine-rich repeat | 193..216 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 217..240 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 241..267 | CDD:275380 | 7/25 (28%) | ||
leucine-rich repeat | 268..291 | CDD:275380 | 5/22 (23%) | ||
LRR_8 | 290..350 | CDD:290566 | 24/59 (41%) | ||
leucine-rich repeat | 292..315 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 316..339 | CDD:275380 | 11/22 (50%) | ||
LRR_8 | 340..400 | CDD:290566 | 21/81 (26%) | ||
leucine-rich repeat | 340..365 | CDD:275380 | 10/46 (22%) | ||
leucine-rich repeat | 366..389 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 390..413 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 391..448 | CDD:290566 | 19/56 (34%) | ||
leucine-rich repeat | 414..437 | CDD:275380 | 6/22 (27%) | ||
Lrrc15 | NP_083249.1 | LRR 1 | 54..75 | 9/20 (45%) | |
leucine-rich repeat | 58..78 | CDD:275380 | 10/22 (45%) | ||
LRR 2 | 78..99 | 7/44 (16%) | |||
PLN00113 | 82..>401 | CDD:215061 | 98/345 (28%) | ||
LRR 3 | 102..123 | 6/20 (30%) | |||
leucine-rich repeat | 103..126 | CDD:275380 | 6/22 (27%) | ||
LRR 4 | 126..147 | 8/20 (40%) | |||
leucine-rich repeat | 127..150 | CDD:275380 | 7/22 (32%) | ||
LRR 5 | 150..171 | 9/20 (45%) | |||
leucine-rich repeat | 151..174 | CDD:275380 | 10/22 (45%) | ||
LRR 6 | 174..195 | 6/20 (30%) | |||
leucine-rich repeat | 175..198 | CDD:275380 | 6/22 (27%) | ||
LRR 7 | 198..219 | 4/23 (17%) | |||
leucine-rich repeat | 199..222 | CDD:275380 | 5/25 (20%) | ||
LRR 8 | 222..243 | 8/20 (40%) | |||
leucine-rich repeat | 223..246 | CDD:275380 | 8/22 (36%) | ||
LRR 9 | 246..267 | 10/20 (50%) | |||
leucine-rich repeat | 247..270 | CDD:275380 | 11/22 (50%) | ||
LRR 10 | 270..291 | 8/20 (40%) | |||
leucine-rich repeat | 271..294 | CDD:275380 | 9/22 (41%) | ||
LRR 11 | 294..315 | 0/20 (0%) | |||
leucine-rich repeat | 295..318 | CDD:275380 | 1/22 (5%) | ||
LRR 12 | 318..339 | 7/20 (35%) | |||
leucine-rich repeat | 319..342 | CDD:275380 | 7/22 (32%) | ||
LRR 13 | 342..363 | 8/20 (40%) | |||
leucine-rich repeat | 343..364 | CDD:275380 | 8/20 (40%) | ||
LRR 14 | 366..387 | 6/20 (30%) | |||
leucine-rich repeat | 367..387 | CDD:275380 | 6/19 (32%) | ||
LRR 15 | 390..411 | 8/21 (38%) | |||
leucine-rich repeat | 391..412 | CDD:275380 | 8/21 (38%) | ||
LRRCT | 423..>462 | CDD:214507 | 4/5 (80%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 476..509 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |