DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32055 and Vasn

DIOPT Version :9

Sequence 1:NP_729599.1 Gene:CG32055 / 39188 FlyBaseID:FBgn0052055 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_001102852.1 Gene:Vasn / 679921 RGDID:1598149 Length:673 Species:Rattus norvegicus


Alignment Length:306 Identity:88/306 - (28%)
Similarity:130/306 - (42%) Gaps:55/306 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 VLPKLEELHLHSNWLEHLDMGIFYALPNLRVLNVSNNNLFEIKRTLFMAPGEIAPLELLDYSSNI 277
            |.|....|::..|.:..||:|.|...|.|::|::|.|.:..:...:|.   .:..|..||.::|.
  Rat    51 VPPDTVGLYIFENGITTLDVGCFAGFPGLQLLDLSQNQITSLPGGIFQ---PLVNLSNLDLTANK 112

  Fly   278 VKVLDDSVFCRLKKLRTLNLWLNQINRIHPRAFLGLSSLQTLHLQGNKISILPDDVFANLTALEK 342
            :..:.:..|..|::|..|.|..|:|..|.|.||..|..|..|.|..|::.:||.   .:|..|..
  Rat   113 LHEISNETFRGLRRLERLYLGKNRIRHIQPGAFDALDHLLELKLPDNELRVLPP---LHLPRLLL 174

  Fly   343 LDLSKNNIQK------------------LGLRVFGERI---LRKLIYLDLSNNYIADLHPLALSS 386
            ||||.|:|..                  ||||...|.:   ||.|..||:|:|.:..: |..:..
  Rat   175 LDLSHNSIPALEAGILDTANVEALRLAGLGLRQLDEGLFGRLRNLHDLDVSDNQLGHM-PSVIQG 238

  Fly   387 MPFIKELRLRRNRLVSLDLRMFAPLRQLQLLTINENRLEEIDGEILDTLDRLNHLELNNNRLTFL 451
            :..:..|||..|                       .|:.:|..|.|..|..|..|:::|..|..|
  Rat   239 LRGLTRLRLAGN-----------------------TRIAQIRPEDLAGLTALQELDVSNLSLQAL 280

  Fly   452 P-DLKSSQNLLQLRNITLEGNPWQCLC-LDEITSWLNGRHVSYARP 495
            | ||.|.  ..:||.:....||:.||| |.....|:...||..|.|
  Rat   281 PSDLSSL--FPRLRLLAAARNPFNCLCPLSWFGPWVRESHVVLASP 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32055NP_729599.1 leucine-rich repeat 76..99 CDD:275380
leucine-rich repeat 100..123 CDD:275380
LRR_8 128..180 CDD:290566
leucine-rich repeat 128..147 CDD:275380
leucine-rich repeat 148..171 CDD:275380
leucine-rich repeat 172..192 CDD:275380
LRR_RI <187..400 CDD:238064 61/207 (29%)
LRR_8 192..251 CDD:290566 13/37 (35%)
leucine-rich repeat 193..216 CDD:275380 1/2 (50%)
leucine-rich repeat 217..240 CDD:275380 6/22 (27%)
leucine-rich repeat 241..267 CDD:275380 5/25 (20%)
leucine-rich repeat 268..291 CDD:275380 6/22 (27%)
LRR_8 290..350 CDD:290566 23/59 (39%)
leucine-rich repeat 292..315 CDD:275380 10/22 (45%)
leucine-rich repeat 316..339 CDD:275380 7/22 (32%)
LRR_8 340..400 CDD:290566 24/80 (30%)
leucine-rich repeat 340..365 CDD:275380 13/45 (29%)
leucine-rich repeat 366..389 CDD:275380 6/22 (27%)
leucine-rich repeat 390..413 CDD:275380 4/22 (18%)
LRR_8 391..448 CDD:290566 12/56 (21%)
leucine-rich repeat 414..437 CDD:275380 5/22 (23%)
VasnNP_001102852.1 LRRNT 25..55 CDD:214470 2/3 (67%)
leucine-rich repeat 35..57 CDD:275380 2/5 (40%)
PPP1R42 58..257 CDD:411060 60/228 (26%)
leucine-rich repeat 58..78 CDD:275380 6/19 (32%)
leucine-rich repeat 79..102 CDD:275380 5/25 (20%)
leucine-rich repeat 103..126 CDD:275380 6/22 (27%)
leucine-rich repeat 127..150 CDD:275380 10/22 (45%)
leucine-rich repeat 151..194 CDD:275380 14/45 (31%)
leucine-rich repeat 195..218 CDD:275380 6/22 (27%)
leucine-rich repeat 219..241 CDD:275380 6/22 (27%)
leucine-rich repeat 242..266 CDD:275380 9/46 (20%)
leucine-rich repeat 267..290 CDD:275380 9/24 (38%)
PCC 271..>350 CDD:188093 20/56 (36%)
EGF 410..441 CDD:394967
fn3 469..546 CDD:394996
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.