DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32055 and NYX

DIOPT Version :9

Sequence 1:NP_729599.1 Gene:CG32055 / 39188 FlyBaseID:FBgn0052055 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_001365406.2 Gene:NYX / 60506 HGNCID:8082 Length:476 Species:Homo sapiens


Alignment Length:323 Identity:94/323 - (29%)
Similarity:138/323 - (42%) Gaps:44/323 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 LGENA-----NLRFLSISNNNLRDFQWCHLRVLPKLEELHL-HSNWLEHLDMGIFYALPNLRVLN 245
            |||.|     :||.||:.:|||........:.||:|.||.| |:..|.:|....|.||..||.|:
Human    72 LGERAFGTLPSLRRLSLRHNNLSFITPGAFKGLPRLAELRLAHNGDLRYLHARTFAALSRLRRLD 136

  Fly   246 VSNNNLFEIKRTLFMAPGEIAPLELLDYSSNIVKVLDDSVFCRLKKLRTLNLWLNQINRIHPRAF 310
            ::...||.:            |..||               ..|..||.|..:.|...|: |.|.
Human   137 LAACRLFSV------------PERLL---------------AELPALRELAAFDNLFRRV-PGAL 173

  Fly   311 LGLSSLQTLHLQGNKISILPDDVFANLTALEKLDLSKNNIQKLGLRVFGE-RILRKLIYLDLSNN 374
            .||::|...||:..:|..:.......|..|..|.|..|.::.:....||: .:|..|:   |::|
Human   174 RGLANLTHAHLERGRIEAVASSSLQGLRRLRSLSLQANRVRAVHAGAFGDCGVLEHLL---LNDN 235

  Fly   375 YIADLHPLALSSMPFIKELRLRRNRLVSLDLRMFAPLRQLQLLTINENRLEEIDGEILDTLDRLN 439
            .:|:|...|...:..::.|.|..|.|..:....||.|.:|:||.::.|.:..::......|..|.
Human   236 LLAELPADAFRGLRRLRTLNLGGNALDRVARAWFADLAELELLYLDRNSIAFVEEGAFQNLSGLL 300

  Fly   440 HLELNNNRLTFLPDLKSSQNLLQLRNITLEGNPWQCLC-LDEITSWLNG----RHVSYARPSS 497
            .|.||.||||.|..:....... |..:.|..|||.|.| |:.:..|:.|    ..|..|.|.|
Human   301 ALHLNGNRLTVLAWVAFQPGFF-LGRLFLFRNPWCCDCRLEWLRDWMEGSGRVTDVPCASPGS 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32055NP_729599.1 leucine-rich repeat 76..99 CDD:275380
leucine-rich repeat 100..123 CDD:275380
LRR_8 128..180 CDD:290566
leucine-rich repeat 128..147 CDD:275380
leucine-rich repeat 148..171 CDD:275380
leucine-rich repeat 172..192 CDD:275380 4/9 (44%)
LRR_RI <187..400 CDD:238064 62/219 (28%)
LRR_8 192..251 CDD:290566 22/59 (37%)
leucine-rich repeat 193..216 CDD:275380 8/22 (36%)
leucine-rich repeat 217..240 CDD:275380 10/23 (43%)
leucine-rich repeat 241..267 CDD:275380 5/25 (20%)
leucine-rich repeat 268..291 CDD:275380 3/22 (14%)
LRR_8 290..350 CDD:290566 18/59 (31%)
leucine-rich repeat 292..315 CDD:275380 9/22 (41%)
leucine-rich repeat 316..339 CDD:275380 5/22 (23%)
LRR_8 340..400 CDD:290566 16/60 (27%)
leucine-rich repeat 340..365 CDD:275380 7/25 (28%)
leucine-rich repeat 366..389 CDD:275380 6/22 (27%)
leucine-rich repeat 390..413 CDD:275380 7/22 (32%)
LRR_8 391..448 CDD:290566 17/56 (30%)
leucine-rich repeat 414..437 CDD:275380 5/22 (23%)
NYXNP_001365406.2 LRR_8 61..115 CDD:404697 17/42 (40%)
leucine-rich repeat 63..82 CDD:275380 4/9 (44%)
leucine-rich repeat 83..106 CDD:275380 8/22 (36%)
leucine-rich repeat 107..131 CDD:275380 10/23 (43%)
leucine-rich repeat 132..155 CDD:275380 9/49 (18%)
PPP1R42 150..310 CDD:411060 47/178 (26%)
leucine-rich repeat 156..178 CDD:275380 9/22 (41%)
leucine-rich repeat 179..202 CDD:275380 5/22 (23%)
leucine-rich repeat 203..226 CDD:275380 6/22 (27%)
LRR_8 227..285 CDD:404697 18/60 (30%)
leucine-rich repeat 227..250 CDD:275380 7/25 (28%)
leucine-rich repeat 251..274 CDD:275380 7/22 (32%)
leucine-rich repeat 275..296 CDD:275380 4/20 (20%)
leucine-rich repeat 323..335 CDD:275378 5/11 (45%)
LRRCT 331..>365 CDD:214507 12/32 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.