DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32055 and Fili

DIOPT Version :9

Sequence 1:NP_729599.1 Gene:CG32055 / 39188 FlyBaseID:FBgn0052055 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_001369108.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:789 Species:Drosophila melanogaster


Alignment Length:440 Identity:121/440 - (27%)
Similarity:189/440 - (42%) Gaps:78/440 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ALQVLALLLLSGVFGKDL---------QECEDLG---NGSYLCRE--IESFE-QLNRYVGKNWKS 52
            |:.||.||||:.|.   |         .:|:.||   |...||.:  :|... |||       ..
  Fly    20 AIPVLLLLLLTLVI---LPPETTAFCPSKCQCLGGEANSRALCVDAALEDVPIQLN-------PE 74

  Fly    53 VKVVNEHTGIERAEDGELPGLSTLLQLDLSESGGVTLGEKGLQDFKALQKLNLTHAQLDELKSEQ 117
            .|.:|......|..:..||....|..||||::...|||.|..:....|:.|||:...:..|....
  Fly    75 TKYINLTVNRIRTLEFSLPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHA 139

  Fly   118 FPNPSEMINFDVSYNDILAITTKLMSGFGNLVYANFSENLIAVIEPNAFRHMKNLRFLDLTTNYQ 182
            |...:.::..|:|:|.|..:....:|...:||..:.:.|.|..:|.|.|:.|..|..|....|  
  Fly   140 FKGLTNLLLLDLSFNRIETVHPTALSDLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVFRNN-- 202

  Fly   183 ENITLGENANLRFLSISNNNLRDFQWCHLRVLPKLEELHLHSNWLEHLDMGIFYALPNLRVLNVS 247
                       |.|.:..:||    |            |||:  |:.|||       :|.::...
  Fly   203 -----------RLLDVPASNL----W------------HLHA--LKSLDM-------SLNLVEFV 231

  Fly   248 NNNLFE-IKRTLFMAPGEIAPLELLDYSSNIVKVLDDSVFCRLKKLRTLNLWLNQINRIHPRAFL 311
            .|:.|| :|..|           .|....|::..||.|.|..|..|:.|:|..|.:..:..:...
  Fly   232 RNDSFEGLKELL-----------ALSVQGNVMSELDLSAFEGLISLKHLDLSDNNLTMVPTQQLS 285

  Fly   312 GLSSLQTLHLQGNKISILPDDVFANLTALEKLDLSK-NNIQKLGLRVFGERILRKLIYLDLSNNY 375
            .||:|..|:|.||:.|.||...|.||..|.:|.||: :.:|::..|.|.:....:.::|: :|..
  Fly   286 KLSNLTYLNLGGNRFSQLPAVAFLNLFHLRELHLSRLDFLQRIDSRAFVDNTHLQTLHLN-NNPQ 349

  Fly   376 IADLHPLALSSMPFIKELRLRRNRLVSLDLRMFAPLRQLQLLTINENRLE 425
            ::|:........|.|.|:.::.|.|.:|....| |:.|||.|.:.:|.|:
  Fly   350 LSDIPMRLFQGNPNILEVYMQSNSLQTLYSAQF-PVDQLQKLYLGDNPLQ 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32055NP_729599.1 leucine-rich repeat 76..99 CDD:275380 9/22 (41%)
leucine-rich repeat 100..123 CDD:275380 6/22 (27%)
LRR_8 128..180 CDD:290566 15/51 (29%)
leucine-rich repeat 128..147 CDD:275380 5/18 (28%)
leucine-rich repeat 148..171 CDD:275380 8/22 (36%)
leucine-rich repeat 172..192 CDD:275380 3/19 (16%)
LRR_RI <187..400 CDD:238064 56/214 (26%)
LRR_8 192..251 CDD:290566 14/58 (24%)
leucine-rich repeat 193..216 CDD:275380 5/22 (23%)
leucine-rich repeat 217..240 CDD:275380 7/22 (32%)
leucine-rich repeat 241..267 CDD:275380 6/26 (23%)
leucine-rich repeat 268..291 CDD:275380 7/22 (32%)
LRR_8 290..350 CDD:290566 21/60 (35%)
leucine-rich repeat 292..315 CDD:275380 5/22 (23%)
leucine-rich repeat 316..339 CDD:275380 11/22 (50%)
LRR_8 340..400 CDD:290566 14/60 (23%)
leucine-rich repeat 340..365 CDD:275380 7/25 (28%)
leucine-rich repeat 366..389 CDD:275380 3/22 (14%)
leucine-rich repeat 390..413 CDD:275380 7/22 (32%)
LRR_8 391..448 CDD:290566 12/35 (34%)
leucine-rich repeat 414..437 CDD:275380 5/12 (42%)
FiliNP_001369108.1 leucine-rich repeat 75..97 CDD:275378 5/21 (24%)
leucine-rich repeat 98..121 CDD:275380 9/22 (41%)
LRR_8 120..180 CDD:404697 14/59 (24%)
leucine-rich repeat 122..145 CDD:275380 6/22 (27%)
leucine-rich repeat 146..169 CDD:275380 5/22 (23%)
LRR <161..>354 CDD:227223 64/242 (26%)
leucine-rich repeat 170..193 CDD:275380 8/22 (36%)
leucine-rich repeat 194..217 CDD:275380 10/51 (20%)
leucine-rich repeat 218..265 CDD:275380 17/64 (27%)
leucine-rich repeat 266..289 CDD:275380 5/22 (23%)
leucine-rich repeat 290..313 CDD:275380 11/22 (50%)
leucine-rich repeat 314..338 CDD:275380 7/23 (30%)
LRR_8 337..397 CDD:404697 16/61 (26%)
leucine-rich repeat 339..360 CDD:275380 3/21 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24373
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.