DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32055 and chadla

DIOPT Version :9

Sequence 1:NP_729599.1 Gene:CG32055 / 39188 FlyBaseID:FBgn0052055 Length:534 Species:Drosophila melanogaster
Sequence 2:XP_017210255.1 Gene:chadla / 565474 ZFINID:ZDB-GENE-121205-4 Length:791 Species:Danio rerio


Alignment Length:600 Identity:117/600 - (19%)
Similarity:213/600 - (35%) Gaps:183/600 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 IERAEDGELPGLSTLLQLDLSESGGVTLGEKGLQDFKALQKLNLTHAQLDELKSEQFPNPSEMIN 126
            ::...:|...|||.||||||:.:....|.::......:|::|.|...:::|:....|...:.:..
Zfish    87 VQAVREGAFRGLSRLLQLDLTNNNIDILYQESFDGLSSLKQLYLDRNRIEEIHPGAFAALNSLNL 151

  Fly   127 FDVSYNDILAITTKLMSGFGNLVYANFSENLIAVIEPNAFRHMKNLRFLDLTTN----------- 180
            ..::||.::.:......|..|:...:.|.|.:..:...||..:..|..|:|..|           
Zfish   152 LSLTYNQLVYLPNMAFQGMMNIQMLHLSHNSLNNLATEAFAGLLALTHLNLDHNELQYFPTKTMT 216

  Fly   181 ------------------YQENITLGENANLRFLSISNNNLRDFQWCHLRVLPKLEELHLHSNWL 227
                              .:|::.:   ..|..||:.:|.|:|.....:.:.|.:..|.|..|.|
Zfish   217 RLIEVTHLDMSYNPMTYLVEESVVM---PKLTHLSLKHNALQDLSESTISLSPVISHLDLSFNQL 278

  Fly   228 EHLDMGIFYALPNLRVLNVSNN-----------NLFEIKRTLFMA-----PGEIA--PLELL--- 271
            .::.  ...|..:|..||::.|           .|:.:|..:.:.     |..::  |||.:   
Zfish   279 SYIQ--ALAASTHLTSLNLTGNPIRCTCLLRDLKLWALKSGIRLFGVCAWPPHLSDEPLENVQEQ 341

  Fly   272 --------DYSSNIVK---------VLDDSV---------------FCRL--------------- 289
                    :::|::::         |.:.:|               .|..               
Zfish   342 DLRCRPQDEWTSDVIEEGTKEEEEGVQEKTVSTAKSKKTRKCPKDCLCEYAAQHATCENRGHTKV 406

  Fly   290 -----KKLRTLNLWLNQINRIHPRAFLGLSSLQTLHLQGNKISILPDDVFANLTALEKLDLSKNN 349
                 :|...|::..|..:.:..::|.|:..:.:|||...||..:....|..:..|..|.||.|.
Zfish   407 PSGFPRKTLLLDMRGNHFHYLPSKSFPGIPEVVSLHLDSCKIHEIEGGAFQGMKNLIYLYLSDNQ 471

  Fly   350 IQKLGLRVFGERILRKLIYLDLSNNYIADLHPLA-LSSMPFIKELRLRRNRLVSLD-LRMFAPLR 412
            :..|..:||  ....:::||.|.:|.:......| |:.:|.:.||.|.||.:..|: ..:.:|:.
Zfish   472 LSSLDAKVF--EGAHEIMYLHLEDNKLTHFPSSATLTHIPKLLELHLERNLIAKLEPSGLLSPVL 534

  Fly   413 QLQLLTINENRLEEIDGEILDTLDRLNHLELNNNRLTFLP------------------------- 452
            ||..|.:|.|.:..|..:.||...:|:.|.|.:|.||.:|                         
Zfish   535 QLTGLYLNNNSIATIVPKALDPAPKLDVLHLEDNVLTDVPSDALDHAPLLTELHLSGNLIRWIGP 599

  Fly   453 ------------------------------------DLKSSQNLLQ----------LRNITLEGN 471
                                                .|....|||:          |:|::|..|
Zfish   600 RAFRVVAESLKNLLIDRMGLQKMSVRSLAGFGPRLLSLSLEDNLLEELPDLSPLAGLQNLSLNKN 664

  Fly   472 PWQCLC-LDEITSWL 485
            |..|.| |.....||
Zfish   665 PLMCDCKLLPFYRWL 679

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32055NP_729599.1 leucine-rich repeat 76..99 CDD:275380 7/22 (32%)
leucine-rich repeat 100..123 CDD:275380 5/22 (23%)
LRR_8 128..180 CDD:290566 11/51 (22%)
leucine-rich repeat 128..147 CDD:275380 3/18 (17%)
leucine-rich repeat 148..171 CDD:275380 4/22 (18%)
leucine-rich repeat 172..192 CDD:275380 5/48 (10%)
LRR_RI <187..400 CDD:238064 57/286 (20%)
LRR_8 192..251 CDD:290566 16/69 (23%)
leucine-rich repeat 193..216 CDD:275380 6/22 (27%)
leucine-rich repeat 217..240 CDD:275380 5/22 (23%)
leucine-rich repeat 241..267 CDD:275380 7/43 (16%)
leucine-rich repeat 268..291 CDD:275380 6/77 (8%)
LRR_8 290..350 CDD:290566 16/59 (27%)
leucine-rich repeat 292..315 CDD:275380 4/22 (18%)
leucine-rich repeat 316..339 CDD:275380 6/22 (27%)
LRR_8 340..400 CDD:290566 20/60 (33%)
leucine-rich repeat 340..365 CDD:275380 8/24 (33%)
leucine-rich repeat 366..389 CDD:275380 6/23 (26%)
leucine-rich repeat 390..413 CDD:275380 7/23 (30%)
LRR_8 391..448 CDD:290566 19/57 (33%)
leucine-rich repeat 414..437 CDD:275380 7/22 (32%)
chadlaXP_017210255.1 LRRNT 22..49 CDD:279764
leucine-rich repeat 55..76 CDD:275380
LRR_8 75..135 CDD:290566 14/47 (30%)
leucine-rich repeat 77..100 CDD:275380 3/12 (25%)
leucine-rich repeat 101..124 CDD:275380 7/22 (32%)
leucine-rich repeat 125..148 CDD:275380 5/22 (23%)
leucine-rich repeat 149..172 CDD:275380 3/22 (14%)
LRR_8 172..231 CDD:290566 9/58 (16%)
leucine-rich repeat 173..196 CDD:275380 4/22 (18%)
leucine-rich repeat 197..220 CDD:275380 4/22 (18%)
leucine-rich repeat 221..243 CDD:275380 1/24 (4%)
LRR_8 242..300 CDD:290566 16/59 (27%)
leucine-rich repeat 244..267 CDD:275380 6/22 (27%)
leucine-rich repeat 417..437 CDD:275380 4/19 (21%)
LRR_8 436..496 CDD:290566 18/61 (30%)
leucine-rich repeat 438..461 CDD:275380 6/22 (27%)
LRR_RI <451..658 CDD:238064 43/208 (21%)
leucine-rich repeat 462..485 CDD:275380 8/24 (33%)
leucine-rich repeat 486..510 CDD:275380 6/23 (26%)
leucine-rich repeat 511..535 CDD:275380 7/23 (30%)
LRR_8 535..594 CDD:290566 15/58 (26%)
leucine-rich repeat 536..559 CDD:275380 7/22 (32%)
leucine-rich repeat 560..583 CDD:275380 7/22 (32%)
leucine-rich repeat 584..608 CDD:275380 0/23 (0%)
leucine-rich repeat 609..633 CDD:275380 0/23 (0%)
leucine-rich repeat 634..656 CDD:275380 4/21 (19%)
LRRCT 664..>699 CDD:214507 6/15 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596585
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.