DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32055 and CG18249

DIOPT Version :9

Sequence 1:NP_729599.1 Gene:CG32055 / 39188 FlyBaseID:FBgn0052055 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_001163549.1 Gene:CG18249 / 40964 FlyBaseID:FBgn0037553 Length:559 Species:Drosophila melanogaster


Alignment Length:471 Identity:116/471 - (24%)
Similarity:183/471 - (38%) Gaps:126/471 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 SYNDILAITTKLMSGFGNLVYANFSENLIAVIEPNAFRHMKNLRFLDLTTNYQENITLGENANLR 194
            |...|..:..:|..|...||..|.:...|:   ..:.|.::||..|.:     :..:||.     
  Fly    66 SRQSITWLVLQLTPGLRTLVIRNCATYHIS---KESLRPVENLTSLQM-----QGTSLGV----- 117

  Fly   195 FLSISNNNLRDFQWCHLRVLPKLEELHLHSNWLEHLDMGIFYALPNLRVLNVSNNNLFEIKRTLF 259
                    |||..:   ..:|:||.|.|..|::..:.:..|..|..||:|.:..|.:.||   |.
  Fly   118 --------LRDQIF---NAVPRLEILQLSQNFIHTVHVAAFQGLSKLRLLGLQGNAIAEI---LS 168

  Fly   260 MAPGEIAPLELLDYSSNIVKVLDDSVFCRLKKLRTLNLWLNQINRIHPRAF-------------- 310
            .....:..|..||.|.|.:..|..::|.:.|||:||.|..|.:..:.|...              
  Fly   169 STLDPLMELVHLDLSRNELTTLPQNIFAKNKKLQTLLLNGNPLRILMPDVLGSLPNLRLLDLGHA 233

  Fly   311 -------LGLSSLQTL---------------------------HLQ-GNKISILPDDVFANL--- 337
                   |.|:::|.|                           ||| |||.|::..|:..||   
  Fly   234 AELEVMTLNLTNVQNLVLEGSSLSSLVINGGFIKLQAGNNELNHLQVGNKSSVIEMDLHGNLLNG 298

  Fly   338 --TA--------LEKLDLSKNNIQKL-----GLRVFGER---ILRKLIYLDLSNNYIADLHPLA- 383
              ||        |::||||||.|:.|     ||...|.:   ||..|.:|:|:||.:..|.|.: 
  Fly   299 NDTAALLRGMWNLQRLDLSKNRIEALPQHGSGLDASGTQELLILPSLKFLNLANNQLVRLPPESP 363

  Fly   384 -LSSMPFIKELRLRRNRLVSLDLRMFAPLRQLQLLTINENRLEEIDGEILDTLDRLNHLELNNNR 447
             |||.  :..|.|..|.:::||:.:...|..|:.|.:..|||..|           |:.:|:...
  Fly   364 ILSSR--LSYLDLSHNLMLTLDVAILRSLSVLKGLYVEGNRLNTI-----------NYQKLHEEH 415

  Fly   448 LTFLPDLKSSQNLLQLRNITLEGNPWQCLCLDEITSWLNGRHVS-YARPSSAYFSGRKPLCVVTP 511
                |||.         .:.|..|||......::..:...|.|. .|||.:...:....:.:..|
  Fly   416 ----PDLS---------ELGLHDNPWSSGLYRKMFLYFTDRGVHLQARPQNRVLNKSSRVDIDWP 467

  Fly   512 MDKCLRDLQETKAQGI 527
            .::...:.|:....|:
  Fly   468 PNEGQAEAQKMDPPGV 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32055NP_729599.1 leucine-rich repeat 76..99 CDD:275380
leucine-rich repeat 100..123 CDD:275380
LRR_8 128..180 CDD:290566 12/49 (24%)
leucine-rich repeat 128..147 CDD:275380 4/16 (25%)
leucine-rich repeat 148..171 CDD:275380 5/22 (23%)
leucine-rich repeat 172..192 CDD:275380 4/19 (21%)
LRR_RI <187..400 CDD:238064 78/284 (27%)
LRR_8 192..251 CDD:290566 15/58 (26%)
leucine-rich repeat 193..216 CDD:275380 3/22 (14%)
leucine-rich repeat 217..240 CDD:275380 7/22 (32%)
leucine-rich repeat 241..267 CDD:275380 7/25 (28%)
leucine-rich repeat 268..291 CDD:275380 7/22 (32%)
LRR_8 290..350 CDD:290566 31/121 (26%)
leucine-rich repeat 292..315 CDD:275380 8/43 (19%)
leucine-rich repeat 316..339 CDD:275380 12/55 (22%)
LRR_8 340..400 CDD:290566 27/69 (39%)
leucine-rich repeat 340..365 CDD:275380 14/32 (44%)
leucine-rich repeat 366..389 CDD:275380 10/24 (42%)
leucine-rich repeat 390..413 CDD:275380 6/22 (27%)
LRR_8 391..448 CDD:290566 14/56 (25%)
leucine-rich repeat 414..437 CDD:275380 6/22 (27%)
CG18249NP_001163549.1 leucine-rich repeat 57..80 CDD:275380 3/13 (23%)
LRR_8 104..163 CDD:290566 20/79 (25%)
leucine-rich repeat 105..128 CDD:275380 7/43 (16%)
LRR_RI 107..438 CDD:238064 97/380 (26%)
leucine-rich repeat 129..152 CDD:275380 7/22 (32%)
leucine-rich repeat 153..176 CDD:275380 7/25 (28%)
LRR_8 176..232 CDD:290566 15/55 (27%)
leucine-rich repeat 177..200 CDD:275380 7/22 (32%)
leucine-rich repeat 201..224 CDD:275380 6/22 (27%)
leucine-rich repeat 225..258 CDD:275380 4/32 (13%)
leucine-rich repeat 259..310 CDD:275380 12/50 (24%)
leucine-rich repeat 311..344 CDD:275380 14/32 (44%)
LRR_8 343..403 CDD:290566 19/61 (31%)
leucine-rich repeat 345..368 CDD:275380 9/22 (41%)
leucine-rich repeat 369..390 CDD:275380 5/20 (25%)
leucine-rich repeat 393..417 CDD:275380 8/38 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453608
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.