DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32055 and rtn4rl2a

DIOPT Version :9

Sequence 1:NP_729599.1 Gene:CG32055 / 39188 FlyBaseID:FBgn0052055 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_982346.1 Gene:rtn4rl2a / 403307 ZFINID:ZDB-GENE-040310-4 Length:458 Species:Danio rerio


Alignment Length:281 Identity:72/281 - (25%)
Similarity:126/281 - (44%) Gaps:53/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 VSNNNLFEIKRTLFMAPGEIAPLELLDYSSNIVKVLDDSVFCRLKKLRTLNLWLN-QINRIHPRA 309
            :.||.:.|::...|....::..|    :|:||..: :...|..|:.|..|:|..| .::|:...|
Zfish    77 LQNNRITELRVGSFAFGTQVLWL----FSNNITWI-EAGAFSELRDLEELDLGDNPNLHRLEGGA 136

  Fly   310 FLGLSSLQTLHLQGNKISILPDDVFANLTALEKLDLSKNNIQKLGLRVFGERILRKLIYLDLSNN 374
            |.||..||:||:...|::.||.|:|..|.:|:.|.|.:|.:          ..::..::.||.| 
Zfish   137 FRGLEKLQSLHMHRCKLAALPHDIFHKLYSLQFLYLQENQL----------HFIQDDLFADLIN- 190

  Fly   375 YIADLHPLALSSMPFIKELRLRRNRLVSLDLRMFAPLRQLQLLTINENRLEEIDGEILDTLDRLN 439
                           :.:|.|..||:.:|...:|..|..|..|.:::||:.:::......|.:|.
Zfish   191 ---------------LSQLFLHGNRIRTLSENVFRGLVNLDRLLLHDNRVRQVNRRAFRDLGQLT 240

  Fly   440 HLELNNNRLTFLPDLKSSQNLLQLRNITLEGNPWQCLCLDEITSWLNGRHVSYARPSSAYFSGRK 504
            .|.|.||.|..||. ::.:::..:..:.|..|||.|.|              .|||...:|.|.:
Zfish   241 MLFLFNNSLAELPG-QAMRDVSSIEFLRLNNNPWACGC--------------EARPLWEFFRGAR 290

  Fly   505 -----PLCVVTPMDKCLRDLQ 520
                 .|| .:|..:..:||:
Zfish   291 LSSSEVLC-ASPASRRGQDLR 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32055NP_729599.1 leucine-rich repeat 76..99 CDD:275380
leucine-rich repeat 100..123 CDD:275380
LRR_8 128..180 CDD:290566
leucine-rich repeat 128..147 CDD:275380
leucine-rich repeat 148..171 CDD:275380
leucine-rich repeat 172..192 CDD:275380
LRR_RI <187..400 CDD:238064 39/154 (25%)
LRR_8 192..251 CDD:290566 2/4 (50%)
leucine-rich repeat 193..216 CDD:275380
leucine-rich repeat 217..240 CDD:275380
leucine-rich repeat 241..267 CDD:275380 4/20 (20%)
leucine-rich repeat 268..291 CDD:275380 6/22 (27%)
LRR_8 290..350 CDD:290566 23/60 (38%)
leucine-rich repeat 292..315 CDD:275380 9/23 (39%)
leucine-rich repeat 316..339 CDD:275380 10/22 (45%)
LRR_8 340..400 CDD:290566 10/59 (17%)
leucine-rich repeat 340..365 CDD:275380 4/24 (17%)
leucine-rich repeat 366..389 CDD:275380 3/22 (14%)
leucine-rich repeat 390..413 CDD:275380 7/22 (32%)
LRR_8 391..448 CDD:290566 17/56 (30%)
leucine-rich repeat 414..437 CDD:275380 5/22 (23%)
rtn4rl2aNP_982346.1 leucine-rich repeat 53..70 CDD:275380
LRR_8 73..127 CDD:290566 13/54 (24%)
leucine-rich repeat 73..93 CDD:275380 4/15 (27%)
LRR_RI 94..>329 CDD:238064 68/264 (26%)
leucine-rich repeat 95..117 CDD:275380 6/26 (23%)
leucine-rich repeat 118..142 CDD:275380 9/23 (39%)
leucine-rich repeat 143..166 CDD:275380 10/22 (45%)
LRR_8 166..225 CDD:290566 17/84 (20%)
leucine-rich repeat 167..190 CDD:275380 6/32 (19%)
leucine-rich repeat 191..214 CDD:275380 7/22 (32%)
LRR_8 214..272 CDD:290566 14/58 (24%)
leucine-rich repeat 215..238 CDD:275380 5/22 (23%)
leucine-rich repeat 239..262 CDD:275380 8/23 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.