DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32055 and Toll-9

DIOPT Version :9

Sequence 1:NP_729599.1 Gene:CG32055 / 39188 FlyBaseID:FBgn0052055 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_001246846.1 Gene:Toll-9 / 40245 FlyBaseID:FBgn0036978 Length:900 Species:Drosophila melanogaster


Alignment Length:415 Identity:101/415 - (24%)
Similarity:157/415 - (37%) Gaps:88/415 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 FPNPSEMINFDVSYNDILAITTKLMSGFGNLVYANFSENLIAVIEPNAFRHMKNLRFLD------ 176
            ||....::..|:|...|..::.:......||.....|:|.|..|..:.|.:::.:::||      
  Fly   258 FPKMPRLVELDISNCSIEYVSKEAFRNVSNLRRLFMSDNKIMTISHDTFYYVQGVQYLDLSFTNF 322

  Fly   177 LTTNYQENI-TLGENANLRF-LSISNNNLRDFQWCHLRVLPKLEELHL-HSNWLEHLDMGIFYAL 238
            ||.:||..: ||....:|.: |.|..|        ..:.||:|..|.| ||....:..:...:..
  Fly   323 LTYSYQLQLPTLEMALSLIYGLKIQQN--------VFKYLPELIYLDLSHSKMTRNSAVAFAHLG 379

  Fly   239 PNLRVLNVSNNNLFEIKRTLFMAPGEIAPLELLDYSSN---IVKVLDDS-----------VFCR- 288
            ..|:.|::....:..:..|:|    :...||.||.|.|   ...::||:           .|.| 
  Fly   380 DKLKFLSLCYTAIPMVSSTIF----KNTVLEGLDLSGNPYLSYNIIDDAFDGIANTLKYLYFERS 440

  Fly   289 ----------LKKLRTLNLWLNQINRIHPRAFLGLSSLQTLHLQGNKISILPDDVFANLTALEKL 343
                      ||.|:.|.|..|.||.:.|..|..|.||:.|.|..|.:.......|.|.:||..|
  Fly   441 NIKDLEWSKSLKNLQVLGLAGNNINALTPAMFQSLESLEILDLSSNHVGNWYRSAFHNNSALRVL 505

  Fly   344 DLSKNNIQKLGLRVFGERILRKLIYLDL-SNNYIADLHPLALSSMPFIKELRLRRNRLVSLDLRM 407
            :|..|.|..|...:..:  ..:|.||.| .|::|.|.|..|      :.|:....|:......| 
  Fly   506 NLRSNTINMLSNEMLKD--FERLDYLSLGDNDFICDCHLRA------VVEVAAANNKDADCSYR- 561

  Fly   408 FAPLRQLQLLTINENRLEEIDGEILDTLDRLNHLELNNNRLTFLPDLKSSQNLLQLRNITLEGNP 472
                    ||..::|.:.|   |::...:.|            :.|.|    |.|.|.|     |
  Fly   562 --------LLNYSQNAVGE---EVISLAESL------------IIDRK----LWQSRYI-----P 594

  Fly   473 WQCLCLDEITSWLNGRHVSYARPSS 497
            |.......|..:....|:...|.||
  Fly   595 WLQRSYSNIREFNRANHIIKLRFSS 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32055NP_729599.1 leucine-rich repeat 76..99 CDD:275380
leucine-rich repeat 100..123 CDD:275380 2/4 (50%)
LRR_8 128..180 CDD:290566 14/57 (25%)
leucine-rich repeat 128..147 CDD:275380 3/18 (17%)
leucine-rich repeat 148..171 CDD:275380 6/22 (27%)
leucine-rich repeat 172..192 CDD:275380 8/26 (31%)
LRR_RI <187..400 CDD:238064 62/240 (26%)
LRR_8 192..251 CDD:290566 13/60 (22%)
leucine-rich repeat 193..216 CDD:275380 5/23 (22%)
leucine-rich repeat 217..240 CDD:275380 5/23 (22%)
leucine-rich repeat 241..267 CDD:275380 4/25 (16%)
leucine-rich repeat 268..291 CDD:275380 11/47 (23%)
LRR_8 290..350 CDD:290566 22/59 (37%)
leucine-rich repeat 292..315 CDD:275380 9/22 (41%)
leucine-rich repeat 316..339 CDD:275380 6/22 (27%)
LRR_8 340..400 CDD:290566 17/60 (28%)
leucine-rich repeat 340..365 CDD:275380 6/24 (25%)
leucine-rich repeat 366..389 CDD:275380 9/23 (39%)
leucine-rich repeat 390..413 CDD:275380 3/22 (14%)
LRR_8 391..448 CDD:290566 9/56 (16%)
leucine-rich repeat 414..437 CDD:275380 5/22 (23%)
Toll-9NP_001246846.1 leucine-rich repeat 157..185 CDD:275380
LRR_8 262..322 CDD:290566 12/59 (20%)
leucine-rich repeat 264..287 CDD:275380 3/22 (14%)
leucine-rich repeat 288..311 CDD:275380 6/22 (27%)
leucine-rich repeat 312..356 CDD:275380 13/51 (25%)
LRR_8 <344..387 CDD:290566 12/50 (24%)
leucine-rich repeat 357..381 CDD:275380 5/23 (22%)
leucine-rich repeat 382..397 CDD:275380 2/14 (14%)
leucine-rich repeat 405..430 CDD:275380 8/24 (33%)
LRR_8 431..488 CDD:290566 18/56 (32%)
leucine-rich repeat 432..453 CDD:275380 3/20 (15%)
LRR_RI <449..536 CDD:238064 30/88 (34%)
leucine-rich repeat 454..477 CDD:275380 9/22 (41%)
LRR_8 477..536 CDD:290566 19/60 (32%)
leucine-rich repeat 478..501 CDD:275380 6/22 (27%)
leucine-rich repeat 502..525 CDD:275380 6/24 (25%)
TIR 751..891 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453516
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.