DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32055 and caps

DIOPT Version :9

Sequence 1:NP_729599.1 Gene:CG32055 / 39188 FlyBaseID:FBgn0052055 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_001303391.1 Gene:caps / 39493 FlyBaseID:FBgn0023095 Length:811 Species:Drosophila melanogaster


Alignment Length:505 Identity:121/505 - (23%)
Similarity:187/505 - (37%) Gaps:126/505 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ECED------LGNGSYLCREIESFEQLNRYVGKNWKSVKVVNEHTGIERAEDGELPGLSTLLQLD 80
            ||:|      .|.|:.....|.....:.|.|.||.| :|.:          |..:...:.|..||
  Fly    48 ECDDDTLMVNCGEGTLDVLPIALNPAIQRLVIKNNK-LKTI----------DSSMQFYAQLTFLD 101

  Fly    81 LSESGGVTLGEKGLQDFKALQKLNLTHAQLDELKSEQFPNPSEMINFDVSYNDILAITTKLMSGF 145
            ||.:..:|:.|:.......||:|:|.|.::.::.::.|...|.:...::..|.|..:..:..|..
  Fly   102 LSFNDMLTIPERSFAYHAKLQELHLDHNKIGQVSNKTFLGLSTISVLNLRGNLIAELEYRTFSPM 166

  Fly   146 GNLVYANFSENLIAVIEPNAFRHMKNLRFLDLTTNYQENITLGENANLRFLSISNNNLRDFQWCH 210
            ..|...|..:|.|:.|:|:|...:.|||.|.|..|....:. ||   |.|               
  Fly   167 VKLAELNLGQNRISHIDPHALDGLDNLRVLYLDDNTLTTVP-GE---LTF--------------- 212

  Fly   211 LRVLPKLEELHLHSNWLEHLDMGIFYALPNLRVLNVSNNNLFEIKRTLFMAPGEIAPLELLDYSS 275
             :.|..|.||:|.:|....:..|.|..|..|..|::....|..|.......   :..|..||.|.
  Fly   213 -QALHSLAELYLGTNSFMTIPGGAFQDLKGLTRLDLRGAGLHNISGDALKG---LVSLRFLDLSD 273

  Fly   276 NIVKVLDDSVFCRLKKLRTLNLWLNQINRIHPRAFLGLSSLQTLHLQG-NKISILPDDVFANLTA 339
            |.:..:..:.|.||.:|..||:..|....|...||.||..|:.|.|.| .::..:....|:..|.
  Fly   274 NRLPAIPTAAFQRLGRLEQLNIGQNDFEVISSGAFSGLRELRHLELTGAQRLRRVESGAFSGNTN 338

  Fly   340 LEKLDLSKNNIQKLGLRVFGERILRKLIYLDLSNNYIADLHPLALSSMPFIKELRLRRNRLVSLD 404
            ||.|:||                         ||..:.:|..:||..:|.:..:.|:.|:|.|||
  Fly   339 LEHLNLS-------------------------SNKQLNELSSIALGGLPHLSTVVLKANQLSSLD 378

  Fly   405 LRMFAPLRQLQLLTINENRLEEIDGEILDTLDRLNHLELNNNRLTFLPDLKSSQNLLQLRNITLE 469
             ....|...||.|.::|                                                
  Fly   379 -EGLVPWADLQTLDLSE------------------------------------------------ 394

  Fly   470 GNPWQCLCLDEITSWLNGRHVSYARPSSAYFSGRKPLCVVTPMDKCLRDL 519
             ||::|.|.   ..||  ||:..:|.:|..::   |:....|  ..||||
  Fly   395 -NPFECDCR---LLWL--RHLLVSRNASGQYA---PVICAYP--TALRDL 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32055NP_729599.1 leucine-rich repeat 76..99 CDD:275380 7/22 (32%)
leucine-rich repeat 100..123 CDD:275380 6/22 (27%)
LRR_8 128..180 CDD:290566 15/51 (29%)
leucine-rich repeat 128..147 CDD:275380 3/18 (17%)
leucine-rich repeat 148..171 CDD:275380 7/22 (32%)
leucine-rich repeat 172..192 CDD:275380 7/19 (37%)
LRR_RI <187..400 CDD:238064 53/213 (25%)
LRR_8 192..251 CDD:290566 13/58 (22%)
leucine-rich repeat 193..216 CDD:275380 3/22 (14%)
leucine-rich repeat 217..240 CDD:275380 8/22 (36%)
leucine-rich repeat 241..267 CDD:275380 4/25 (16%)
leucine-rich repeat 268..291 CDD:275380 8/22 (36%)
LRR_8 290..350 CDD:290566 20/60 (33%)
leucine-rich repeat 292..315 CDD:275380 9/22 (41%)
leucine-rich repeat 316..339 CDD:275380 5/23 (22%)
LRR_8 340..400 CDD:290566 13/59 (22%)
leucine-rich repeat 340..365 CDD:275380 5/24 (21%)
leucine-rich repeat 366..389 CDD:275380 5/22 (23%)
leucine-rich repeat 390..413 CDD:275380 7/22 (32%)
LRR_8 391..448 CDD:290566 11/56 (20%)
leucine-rich repeat 414..437 CDD:275380 4/22 (18%)
capsNP_001303391.1 leucine-rich repeat 75..96 CDD:275380 7/31 (23%)
LRR_8 96..155 CDD:290566 15/58 (26%)
leucine-rich repeat 97..120 CDD:275380 7/22 (32%)
leucine-rich repeat 121..144 CDD:275380 6/22 (27%)
LRR_8 143..201 CDD:290566 16/57 (28%)
leucine-rich repeat 145..168 CDD:275380 3/22 (14%)
LRR_RI 147..397 CDD:238064 79/347 (23%)
leucine-rich repeat 169..192 CDD:275380 7/22 (32%)
leucine-rich repeat 193..217 CDD:275380 10/43 (23%)
LRR_8 217..276 CDD:290566 17/61 (28%)
leucine-rich repeat 218..241 CDD:275380 8/22 (36%)
leucine-rich repeat 242..265 CDD:275380 4/25 (16%)
LRR_8 265..321 CDD:290566 20/55 (36%)
leucine-rich repeat 266..289 CDD:275380 8/22 (36%)
leucine-rich repeat 290..313 CDD:275380 9/22 (41%)
LRR_8 312..374 CDD:290566 19/86 (22%)
leucine-rich repeat 314..335 CDD:275380 5/20 (25%)
leucine-rich repeat 339..363 CDD:275380 10/48 (21%)
LRRCT 395..445 CDD:214507 16/49 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472908
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.