DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32055 and 18w

DIOPT Version :9

Sequence 1:NP_729599.1 Gene:CG32055 / 39188 FlyBaseID:FBgn0052055 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_476814.1 Gene:18w / 37277 FlyBaseID:FBgn0004364 Length:1385 Species:Drosophila melanogaster


Alignment Length:571 Identity:145/571 - (25%)
Similarity:242/571 - (42%) Gaps:76/571 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DLQECEDLGNGSYLC----REIESFEQL------------NRYVG-------------KNWKSVK 54
            |||..::|.:.|.|.    |:::...:|            |.:.|             ..|...|
  Fly    68 DLQCSQELLHASELAPGLFRQLQKLSELRIDACKLQRVPPNAFEGLMSLKRLTLESHNAVWGPGK 132

  Fly    55 VVNEHTGIERAEDGE-LPGLSTLLQLDLSESGGVTLGEKGLQDFKALQKLNLTHAQLDELKSEQF 118
            .:..|        |: ..||..|.:|.|.::....|.|.......:||.||||.   :.::|.:|
  Fly   133 TLELH--------GQSFQGLKELSELHLGDNNIRQLPEGVWCSMPSLQLLNLTQ---NRIRSAEF 186

  Fly   119 --------------------PNPSEMINFDVSYNDILAITTKL-MSGFGNLVYANFSENLIAVIE 162
                                ...||:...|||:|::.::.... .|....|...:...|.|:.:.
  Fly   187 LGFSEKLCAGSALSNANGAVSGGSELQTLDVSFNELRSLPDAWGASRLRRLQTLSLQHNNISTLA 251

  Fly   163 PNAFRHMKNLRFLDLTTNYQENI---TLGENANLRFLSISNNNLRDFQWCHLRVLPKLEELHLHS 224
            |||...:.:||.|:::.|:..::   ....|..||.|.:..|:|.:.....|..|.:|..|.|..
  Fly   252 PNALAGLSSLRVLNISYNHLVSLPSEAFAGNKELRELHLQGNDLYELPKGLLHRLEQLLVLDLSG 316

  Fly   225 NWL--EHLDMGIFYALPNLRVLNVSNNNLFEIKRTLFMAPGEIAPLELLDYSSNIVKVLDDSVFC 287
            |.|  .|:|...|..|..|.|||:|||.|..|....|.   |:..|::||..:|.:..:::..|.
  Fly   317 NQLTSHHVDNSTFAGLIRLIVLNLSNNALTRIGSKTFK---ELYFLQILDMRNNSIGHIEEGAFL 378

  Fly   288 RLKKLRTLNLWLNQINRIHPRAFLGLSSLQTLHLQGNKISILPDDVFANLTALEKLDLSKNNIQK 352
            .|..|.||||..|:::.:..|.|.||..|..|.|..|.:||:....|.|.:.|::||||.|.:.:
  Fly   379 PLYNLHTLNLAENRLHTLDNRIFNGLYVLTKLTLNNNLVSIVESQAFRNCSDLKELDLSSNQLTE 443

  Fly   353 LGLRVFGERILRKLIYLDLSNNYIADLHPLALSSMPFIKELRLRRNRLVSLDLRMFAPLRQLQLL 417
            :...|   :.|..|..|||..|.|::.......::..:..|||..||:.::.:.||..|.:|.:|
  Fly   444 VPEAV---QDLSMLKTLDLGENQISEFKNNTFRNLNQLTGLRLIDNRIGNITVGMFQDLPRLSVL 505

  Fly   418 TINENRLEEIDGEILDTLDRLNHLELNNNRLTFLPDLKSSQNLLQLRNITLEGNPW-QCLCLDEI 481
            .:.:||::.|:....|....:..:.|:.|.||.:..:.::...|...|::.....| ....:...
  Fly   506 NLAKNRIQSIERGAFDKNTEIEAIRLDKNFLTDINGIFATLASLLWLNLSENHLVWFDYAFIPSN 570

  Fly   482 TSWLNGRHVSYARPSSAYFSGRKPLCVVTPMDKCLRDLQETKAQGIVESYE 532
            ..||: .|.:|......|:..::.:.|.| :|.....:.|..|..:..|.|
  Fly   571 LKWLD-IHGNYIEALGNYYKLQEEIRVTT-LDASHNRITEIGAMSVPNSIE 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32055NP_729599.1 leucine-rich repeat 76..99 CDD:275380 5/22 (23%)
leucine-rich repeat 100..123 CDD:275380 8/42 (19%)
LRR_8 128..180 CDD:290566 14/52 (27%)
leucine-rich repeat 128..147 CDD:275380 5/19 (26%)
leucine-rich repeat 148..171 CDD:275380 6/22 (27%)
leucine-rich repeat 172..192 CDD:275380 5/22 (23%)
LRR_RI <187..400 CDD:238064 70/214 (33%)
LRR_8 192..251 CDD:290566 23/60 (38%)
leucine-rich repeat 193..216 CDD:275380 7/22 (32%)
leucine-rich repeat 217..240 CDD:275380 9/24 (38%)
leucine-rich repeat 241..267 CDD:275380 11/25 (44%)
leucine-rich repeat 268..291 CDD:275380 6/22 (27%)
LRR_8 290..350 CDD:290566 24/59 (41%)
leucine-rich repeat 292..315 CDD:275380 10/22 (45%)
leucine-rich repeat 316..339 CDD:275380 8/22 (36%)
LRR_8 340..400 CDD:290566 18/59 (31%)
leucine-rich repeat 340..365 CDD:275380 8/24 (33%)
leucine-rich repeat 366..389 CDD:275380 6/22 (27%)
leucine-rich repeat 390..413 CDD:275380 8/22 (36%)
LRR_8 391..448 CDD:290566 16/56 (29%)
leucine-rich repeat 414..437 CDD:275380 6/22 (27%)
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380 7/22 (32%)
leucine-rich repeat 92..115 CDD:275380 3/22 (14%)
LRR_8 115..181 CDD:290566 17/76 (22%)
leucine-rich repeat 116..146 CDD:275380 6/37 (16%)
leucine-rich repeat 147..170 CDD:275380 5/22 (23%)
leucine-rich repeat 171..201 CDD:275380 8/32 (25%)
LRR_RI 210..464 CDD:238064 82/259 (32%)
leucine-rich repeat 212..236 CDD:275380 5/23 (22%)
LRR_8 235..295 CDD:290566 15/59 (25%)
leucine-rich repeat 237..260 CDD:275380 6/22 (27%)
leucine-rich repeat 261..284 CDD:275380 5/22 (23%)
LRR_8 283..345 CDD:290566 23/61 (38%)
leucine-rich repeat 285..308 CDD:275380 7/22 (32%)
leucine-rich repeat 309..334 CDD:275380 9/24 (38%)
LRR_8 334..393 CDD:290566 23/61 (38%)
leucine-rich repeat 335..358 CDD:275380 11/25 (44%)
leucine-rich repeat 359..382 CDD:275380 6/22 (27%)
LRR_8 382..441 CDD:290566 24/58 (41%)
leucine-rich repeat 383..406 CDD:275380 10/22 (45%)
leucine-rich repeat 407..430 CDD:275380 8/22 (36%)
LRR_8 431..488 CDD:290566 18/59 (31%)
leucine-rich repeat 431..451 CDD:275380 7/22 (32%)
leucine-rich repeat 454..477 CDD:275380 6/22 (27%)
LRR_8 477..559 CDD:290566 20/81 (25%)
leucine-rich repeat 478..499 CDD:275380 7/20 (35%)
leucine-rich repeat 502..525 CDD:275380 6/22 (27%)
leucine-rich repeat 526..548 CDD:275380 4/21 (19%)
leucine-rich repeat 590..617 CDD:275380 5/27 (19%)
leucine-rich repeat 618..641 CDD:275380 1/2 (50%)
leucine-rich repeat 642..689 CDD:275380
LRRCT 679..736 CDD:214507
leucine-rich repeat 775..796 CDD:275380
LRR_8 797..852 CDD:290566
leucine-rich repeat 797..817 CDD:275380
leucine-rich repeat 818..841 CDD:275380
LRR_8 841..900 CDD:290566
leucine-rich repeat 842..865 CDD:275380
LRR_4 866..907 CDD:289563
leucine-rich repeat 866..889 CDD:275380
leucine-rich repeat 890..911 CDD:275380
TIR 1045..1183 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453560
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.