DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32055 and CG4168

DIOPT Version :9

Sequence 1:NP_729599.1 Gene:CG32055 / 39188 FlyBaseID:FBgn0052055 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_001285953.1 Gene:CG4168 / 34889 FlyBaseID:FBgn0028888 Length:1330 Species:Drosophila melanogaster


Alignment Length:566 Identity:152/566 - (26%)
Similarity:240/566 - (42%) Gaps:102/566 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQALQVL-ALLLLSGV--FGKDLQECEDLGNGSYL-CREIE----SFEQLNRYVGKNWKS----- 52
            :::|..| |||.||.:  .|.|....:.:.|.|:. .||:.    ||.||.......::|     
  Fly   575 LESLDPLDALLPLSQLIWLGLDNNNLKQVSNESFAQMRELSYINLSFNQLKTLPRGLFQSDAHSH 639

  Fly    53 -VKVVNEHTGIERAED------GELP------------------GLSTLLQLDLSESGGVTLGEK 92
             |::...:.|:||.|.      |:|.                  .|..|..||||.:..|.:...
  Fly   640 LVEIDLSYNGLERLEAQTFHSLGDLQTLNLQSNRLRTIARHAFHNLEFLRYLDLSYNRLVNISHG 704

  Fly    93 GLQDFKALQKLNLTHAQLDELKSEQF---PNPSEMINFDVSYNDILAITTKLMSGFGNLVYANFS 154
            .......|..|:|.|.||..|..:.|   .|.:..:..:||:|.|.:...:| |.:..:...:.|
  Fly   705 AFTVLPNLAALDLMHNQLCSLSLKSFLYVSNTTTPLRLNVSHNHIASFYDEL-SSYMYIYQLDIS 768

  Fly   155 ENLIAVIEPNAFRHMKN-LRFLDLTTNYQENI---TLGENANLRFLSISNNNLRDFQWCHLRVLP 215
            .|  .|.:.::|.::.| ||||:|..|...::   ..|:...|..|::::|||...:....:.|.
  Fly   769 HN--HVTKSDSFTNLANTLRFLNLAHNQLGSLQSHAFGDLEFLEILNVAHNNLTSLRRRSFQGLN 831

  Fly   216 KLEELHLHSNWLEHLDMGIFYALPNLRVLNVSNNNLFEIKRTLFMAPGEIAPLELLDYSSNIVKV 280
            .|:||.|..|.|:.|.:..|..|..||:|.:::|.|..:.|.:||.    ..||.||.:.|.:.|
  Fly   832 SLQELDLSHNQLDQLQVEQFSNLRKLRILRINSNRLRALPREVFMN----TRLEFLDIAENQLSV 892

  Fly   281 LDDSVFCRLK-KLRTLNLWLNQINRIHPRAFLGLSSLQTLHLQGNKISILPDDVFANLTALEKLD 344
            .....|..:. .||::.:..|.:..:....|:....|..:.|..|:|:||||:.|:.|..|..||
  Fly   893 WPVPAFTDIGFTLRSIQMSHNNLEYLDASMFINSQFLYDISLARNRITILPDNTFSFLNNLTNLD 957

  Fly   345 LSKN---------------NIQKLGLRVFGERILRK-----LIYLDLSNNYIADLHPLALSSMPF 389
            ||:|               .::||.|...|..:|..     |.|||:|.||:.:|.|  |.|:..
  Fly   958 LSQNPLVTTNLREVFVHTPRLRKLSLHHMGLYVLPPLKLPLLSYLDVSGNYLQELSP--LGSLRH 1020

  Fly   390 IKELRLRRNRLVSLDLRMFAPLRQLQLLTINENRLEEIDGEILDTLDRLNHL-ELN--------- 444
            ::.:.:..|:|.:...........:::|.:..|.|..|   .|..|..|.|| |||         
  Fly  1021 LRHVNVSHNKLTNASCAAEHLPPSVRVLDLAHNPLRRI---TLHDLASLRHLAELNILDVKVTNP 1082

  Fly   445 --NNRLTFLPDLKSSQN------------LLQLRNITLEGNPWQCL 476
              .::|..|..|.:|.:            |.|||...||.|..|.|
  Fly  1083 QAFSKLRSLRKLHASSHANLGEIVARIPGLQQLRVHCLEPNIGQQL 1128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32055NP_729599.1 leucine-rich repeat 76..99 CDD:275380 6/22 (27%)
leucine-rich repeat 100..123 CDD:275380 9/25 (36%)
LRR_8 128..180 CDD:290566 16/52 (31%)
leucine-rich repeat 128..147 CDD:275380 6/18 (33%)
leucine-rich repeat 148..171 CDD:275380 4/22 (18%)
leucine-rich repeat 172..192 CDD:275380 7/22 (32%)
LRR_RI <187..400 CDD:238064 68/233 (29%)
LRR_8 192..251 CDD:290566 19/58 (33%)
leucine-rich repeat 193..216 CDD:275380 6/22 (27%)
leucine-rich repeat 217..240 CDD:275380 9/22 (41%)
leucine-rich repeat 241..267 CDD:275380 8/25 (32%)
leucine-rich repeat 268..291 CDD:275380 7/23 (30%)
LRR_8 290..350 CDD:290566 20/75 (27%)
leucine-rich repeat 292..315 CDD:275380 4/22 (18%)
leucine-rich repeat 316..339 CDD:275380 10/22 (45%)
LRR_8 340..400 CDD:290566 23/79 (29%)
leucine-rich repeat 340..365 CDD:275380 11/39 (28%)
leucine-rich repeat 366..389 CDD:275380 11/22 (50%)
leucine-rich repeat 390..413 CDD:275380 2/22 (9%)
LRR_8 391..448 CDD:290566 14/68 (21%)
leucine-rich repeat 414..437 CDD:275380 6/22 (27%)
CG4168NP_001285953.1 leucine-rich repeat 99..118 CDD:275380
LRR_8 121..181 CDD:290566
LRR_RI 122..350 CDD:238064
leucine-rich repeat 122..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380
leucine-rich repeat 171..194 CDD:275380
leucine-rich repeat 195..214 CDD:275380
leucine-rich repeat 215..236 CDD:275380
LRR_8 265..322 CDD:290566
leucine-rich repeat 266..287 CDD:275380
leucine-rich repeat 288..311 CDD:275380
leucine-rich repeat 312..338 CDD:275380
LRR_RI 315..546 CDD:238064
leucine-rich repeat 339..365 CDD:275380
LRR_8 365..424 CDD:290566
leucine-rich repeat 366..388 CDD:275380
leucine-rich repeat 389..412 CDD:275380
LRR_8 413..470 CDD:290566
leucine-rich repeat 414..436 CDD:275380
leucine-rich repeat 437..459 CDD:275380
leucine-rich repeat 460..483 CDD:275380
LRR_8 482..545 CDD:290566
leucine-rich repeat 484..510 CDD:275380
leucine-rich repeat 511..534 CDD:275380
leucine-rich repeat 535..589 CDD:275380 6/13 (46%)
LRR_RI 588..891 CDD:238064 81/309 (26%)
LRR_8 588..650 CDD:290566 13/61 (21%)
leucine-rich repeat 590..613 CDD:275380 4/22 (18%)
leucine-rich repeat 614..639 CDD:275380 5/24 (21%)
LRR_8 638..698 CDD:290566 13/59 (22%)
leucine-rich repeat 640..663 CDD:275380 5/22 (23%)
leucine-rich repeat 664..687 CDD:275380 2/22 (9%)
LRR_8 688..749 CDD:290566 18/60 (30%)
leucine-rich repeat 688..711 CDD:275380 6/22 (27%)
leucine-rich repeat 712..735 CDD:275380 8/22 (36%)
leucine-rich repeat 740..783 CDD:275380 10/45 (22%)
LRR_8 784..843 CDD:290566 18/58 (31%)
leucine-rich repeat 785..808 CDD:275380 7/22 (32%)
leucine-rich repeat 809..832 CDD:275380 6/22 (27%)
LRR_RI <827..1053 CDD:238064 64/231 (28%)
LRR_8 832..890 CDD:290566 22/61 (36%)
leucine-rich repeat 833..856 CDD:275380 9/22 (41%)
leucine-rich repeat 857..879 CDD:275380 8/25 (32%)
leucine-rich repeat 880..900 CDD:275380 7/19 (37%)
LRR_8 904..963 CDD:290566 20/58 (34%)
leucine-rich repeat 905..928 CDD:275380 4/22 (18%)
leucine-rich repeat 929..952 CDD:275380 10/22 (45%)
leucine-rich repeat 953..977 CDD:275380 6/23 (26%)
leucine-rich repeat 978..1020 CDD:275380 16/43 (37%)
LRR_8 1019..1074 CDD:290566 13/57 (23%)
leucine-rich repeat 1045..1068 CDD:275380 7/25 (28%)
leucine-rich repeat 1069..1090 CDD:275380 5/20 (25%)
leucine-rich repeat 1091..1114 CDD:275380 4/22 (18%)
leucine-rich repeat 1115..1161 CDD:275380 7/14 (50%)
leucine-rich repeat 1162..1190 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453505
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D299282at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.