DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32055 and kek5

DIOPT Version :9

Sequence 1:NP_729599.1 Gene:CG32055 / 39188 FlyBaseID:FBgn0052055 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_001245746.1 Gene:kek5 / 32930 FlyBaseID:FBgn0031016 Length:931 Species:Drosophila melanogaster


Alignment Length:382 Identity:74/382 - (19%)
Similarity:122/382 - (31%) Gaps:155/382 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 QW--------CHLRVLPKLEELHLHSNWLEHLDMGIFYALPNLRVLNVSNNNLFEIKRTLFMAPG 263
            ||        |..:.|.|:.:           ||.     ..::||:.::|.:.|::|..|:..|
  Fly    49 QWNSGKKSADCKNKALTKIPQ-----------DMS-----NEMQVLDFAHNQIPELRREEFLLAG 97

  Fly   264 EIAPLELLDYSSNIVKVLDDSVFCRLKKLRTLNLWLNQINRIHPRAFLGLSSLQTLHLQGNKISI 328
                      ..|:.|:.          ||...     |..:|..||.||..|..|.|.||:|..
  Fly    98 ----------LPNVHKIF----------LRNCT-----IQEVHREAFKGLHILIELDLSGNRIRE 137

  Fly   329 LPDDVFANLTALEKLDLSKNNIQKLGLRVFGERILRKLIYLDLSNNYIADLHPLALSSMPFIKEL 393
            |....||.|..|..:.::.|.|:          :|...::::||                |:..:
  Fly   138 LHPGTFAGLEKLRNVIINNNEIE----------VLPNHLFVNLS----------------FLSRI 176

  Fly   394 RLRRNRLVSLDLRMFAPLRQLQLLTINENRLEEIDGEILDTLDRLNHLELNNNRLTFLPDLKSSQ 458
            ..|.|||..:.|.:||....|..:::.:|||..:..|....|.:|.||                 
  Fly   177 EFRNNRLRQVQLHVFAGTMALSAISLEQNRLSHLHKETFKDLQKLMHL----------------- 224

  Fly   459 NLLQLRNITLEGNPWQCLC---------------------------------------------- 477
                    :|:||.|.|.|                                              
  Fly   225 --------SLQGNAWNCSCELQDFRDFAISKRLYTPPTDCQEPPQLRGKLWSEVPSENFACRPRI 281

  Fly   478 LDEITSWLNGRH---------VSYARPSSAYFSGRKPLCVVTPMDKCLRDLQETKAQ 525
            |..:.|::...|         |...||:..:...::||....|..:.|..:::...|
  Fly   282 LGSVRSFIEANHDNISLPCRIVGSPRPNVTWVYNKRPLQQYDPRVRVLTSVEQMPEQ 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32055NP_729599.1 leucine-rich repeat 76..99 CDD:275380
leucine-rich repeat 100..123 CDD:275380
LRR_8 128..180 CDD:290566
leucine-rich repeat 128..147 CDD:275380
leucine-rich repeat 148..171 CDD:275380
leucine-rich repeat 172..192 CDD:275380
LRR_RI <187..400 CDD:238064 43/200 (22%)
LRR_8 192..251 CDD:290566 10/51 (20%)
leucine-rich repeat 193..216 CDD:275380 4/16 (25%)
leucine-rich repeat 217..240 CDD:275380 2/22 (9%)
leucine-rich repeat 241..267 CDD:275380 7/25 (28%)
leucine-rich repeat 268..291 CDD:275380 2/22 (9%)
LRR_8 290..350 CDD:290566 20/59 (34%)
leucine-rich repeat 292..315 CDD:275380 8/22 (36%)
leucine-rich repeat 316..339 CDD:275380 10/22 (45%)
LRR_8 340..400 CDD:290566 9/59 (15%)
leucine-rich repeat 340..365 CDD:275380 4/24 (17%)
leucine-rich repeat 366..389 CDD:275380 2/22 (9%)
leucine-rich repeat 390..413 CDD:275380 7/22 (32%)
LRR_8 391..448 CDD:290566 16/56 (29%)
leucine-rich repeat 414..437 CDD:275380 6/22 (27%)
kek5NP_001245746.1 LRR_RI <76..160 CDD:238064 29/108 (27%)
leucine-rich repeat 76..100 CDD:275380 7/33 (21%)
LRR_8 99..159 CDD:290566 22/74 (30%)
leucine-rich repeat 101..124 CDD:275380 9/37 (24%)
LRR 122..145 CDD:197688 9/22 (41%)
leucine-rich repeat 125..148 CDD:275380 10/22 (45%)
LRR_8 148..207 CDD:290566 16/84 (19%)
leucine-rich repeat 149..172 CDD:275380 6/48 (13%)
leucine-rich repeat 173..196 CDD:275380 7/22 (32%)
LRR_8 197..>229 CDD:290566 10/56 (18%)
leucine-rich repeat 197..220 CDD:275380 6/22 (27%)
LRRCT 229..277 CDD:214507 4/47 (9%)
Ig 296..376 CDD:143165 8/43 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453531
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.