| Sequence 1: | NP_729599.1 | Gene: | CG32055 / 39188 | FlyBaseID: | FBgn0052055 | Length: | 534 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_848663.1 | Gene: | RTN4RL1 / 146760 | HGNCID: | 21329 | Length: | 441 | Species: | Homo sapiens |
| Alignment Length: | 270 | Identity: | 79/270 - (29%) |
|---|---|---|---|
| Similarity: | 105/270 - (38%) | Gaps: | 58/270 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 218 EELHLHSNWLEHLDMGIFYALPNLRVLNVSNNNLFEIKRTLFMAPGEIAPLELLDYSSN-IVKVL 281
Fly 282 DDSVFCRLKKLRTLNLWLNQINRIHPRAFLGLSSLQTLHLQGNKISILPDDVFANLTALEKLDLS 346
Fly 347 KNNIQKLGLRVFGERILRKLIYLDLSNNYIADLHPLALSSMPFIKELRLRRNRLVSLDLRMFAPL 411
Fly 412 RQLQLLTINENRLEEIDGEILDTLDRLNHLELNNNRLTFLPDLKSSQNLLQLRNITLEGNPWQCL 476
Fly 477 C-LDEITSWL 485 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG32055 | NP_729599.1 | leucine-rich repeat | 76..99 | CDD:275380 | |
| leucine-rich repeat | 100..123 | CDD:275380 | |||
| LRR_8 | 128..180 | CDD:290566 | |||
| leucine-rich repeat | 128..147 | CDD:275380 | |||
| leucine-rich repeat | 148..171 | CDD:275380 | |||
| leucine-rich repeat | 172..192 | CDD:275380 | |||
| LRR_RI | <187..400 | CDD:238064 | 54/182 (30%) | ||
| LRR_8 | 192..251 | CDD:290566 | 9/32 (28%) | ||
| leucine-rich repeat | 193..216 | CDD:275380 | |||
| leucine-rich repeat | 217..240 | CDD:275380 | 6/21 (29%) | ||
| leucine-rich repeat | 241..267 | CDD:275380 | 5/25 (20%) | ||
| leucine-rich repeat | 268..291 | CDD:275380 | 8/23 (35%) | ||
| LRR_8 | 290..350 | CDD:290566 | 24/59 (41%) | ||
| leucine-rich repeat | 292..315 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 316..339 | CDD:275380 | 12/22 (55%) | ||
| LRR_8 | 340..400 | CDD:290566 | 14/59 (24%) | ||
| leucine-rich repeat | 340..365 | CDD:275380 | 7/24 (29%) | ||
| leucine-rich repeat | 366..389 | CDD:275380 | 3/22 (14%) | ||
| leucine-rich repeat | 390..413 | CDD:275380 | 6/22 (27%) | ||
| LRR_8 | 391..448 | CDD:290566 | 20/56 (36%) | ||
| leucine-rich repeat | 414..437 | CDD:275380 | 9/22 (41%) | ||
| RTN4RL1 | NP_848663.1 | leucine-rich repeat | 37..54 | CDD:275380 | |
| LRR 1 | 55..76 | 6/20 (30%) | |||
| LRR_8 | 57..111 | CDD:316378 | 16/58 (28%) | ||
| leucine-rich repeat | 57..77 | CDD:275380 | 6/21 (29%) | ||
| LRR 2 | 77..98 | 5/20 (25%) | |||
| leucine-rich repeat | 78..101 | CDD:275380 | 5/25 (20%) | ||
| LRR 3 | 101..123 | 7/21 (33%) | |||
| leucine-rich repeat | 102..126 | CDD:275380 | 8/23 (35%) | ||
| LRR_8 | 126..185 | CDD:316378 | 24/58 (41%) | ||
| LRR 4 | 126..147 | 5/20 (25%) | |||
| leucine-rich repeat | 127..150 | CDD:275380 | 6/22 (27%) | ||
| LRR 5 | 150..171 | 12/20 (60%) | |||
| leucine-rich repeat | 151..174 | CDD:275380 | 12/22 (55%) | ||
| LRR_8 | 174..233 | CDD:316378 | 21/84 (25%) | ||
| LRR 6 | 174..195 | 7/25 (28%) | |||
| leucine-rich repeat | 175..198 | CDD:275380 | 9/27 (33%) | ||
| LRR 7 | 198..219 | 7/41 (17%) | |||
| leucine-rich repeat | 199..222 | CDD:275380 | 8/43 (19%) | ||
| LRR 8 | 222..243 | 8/20 (40%) | |||
| leucine-rich repeat | 223..246 | CDD:275380 | 9/22 (41%) | ||
| TPKR_C2 | 255..300 | CDD:326558 | 7/16 (44%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 304..382 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 397..417 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||