DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32055 and podn

DIOPT Version :10

Sequence 1:NP_729599.1 Gene:CG32055 / 39188 FlyBaseID:FBgn0052055 Length:534 Species:Drosophila melanogaster
Sequence 2:XP_031756818.1 Gene:podn / 101730272 XenbaseID:XB-GENE-963382 Length:598 Species:Xenopus tropicalis


Alignment Length:76 Identity:18/76 - (23%)
Similarity:29/76 - (38%) Gaps:28/76 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KDIKGGEDDKSI---------DIFRAGKGG----RGVTGGKGGGRKAS---------------PK 82
            :|.:|||..|:.         :...|...|    |.:.||:..||.|:               |:
 Frog    14 QDQEGGEAAKAAPEEPQQRPPEAVAAAPAGTTSSRVLRGGRDRGRAAAAAAAAAVSRRRKAEYPR 78

  Fly    83 KRNAAMDHRPP 93
            :|.::...|||
 Frog    79 RRRSSPSARPP 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32055NP_729599.1 leucine-rich repeat 76..99 CDD:275380 8/33 (24%)
leucine-rich repeat 100..123 CDD:275380
LRR_8 126..180 CDD:404697
leucine-rich repeat 128..147 CDD:275380
leucine-rich repeat 148..171 CDD:275380
LRR 171..>486 CDD:443914
leucine-rich repeat 172..192 CDD:275380
leucine-rich repeat 193..216 CDD:275380
leucine-rich repeat 217..240 CDD:275380
leucine-rich repeat 241..267 CDD:275380
leucine-rich repeat 268..291 CDD:275380
leucine-rich repeat 292..315 CDD:275380
leucine-rich repeat 316..339 CDD:275380
leucine-rich repeat 340..365 CDD:275380
leucine-rich repeat 366..389 CDD:275380
leucine-rich repeat 390..413 CDD:275380
leucine-rich repeat 414..437 CDD:275380
podnXP_031756818.1 LRRNT 59..87 CDD:396168 3/27 (11%)
leucine-rich repeat 90..113 CDD:275380 18/76 (24%)
PLN00113 105..>512 CDD:215061
leucine-rich repeat 114..139 CDD:275380
leucine-rich repeat 140..184 CDD:275380
leucine-rich repeat 185..210 CDD:275380
leucine-rich repeat 211..231 CDD:275380
leucine-rich repeat 232..255 CDD:275380
leucine-rich repeat 256..281 CDD:275380
leucine-rich repeat 282..302 CDD:275380
leucine-rich repeat 303..326 CDD:275380
leucine-rich repeat 327..352 CDD:275380
leucine-rich repeat 353..373 CDD:275380
leucine-rich repeat 374..397 CDD:275380
leucine-rich repeat 398..423 CDD:275380
leucine-rich repeat 424..445 CDD:275380
leucine-rich repeat 446..468 CDD:275380
leucine-rich repeat 469..494 CDD:275380
leucine-rich repeat 495..515 CDD:275380
LRR_8 515..575 CDD:404697
leucine-rich repeat 516..539 CDD:275380
leucine-rich repeat 540..565 CDD:275380
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.