DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and Pi15

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_444421.2 Gene:Pi15 / 94227 MGIID:1934659 Length:269 Species:Mus musculus


Alignment Length:186 Identity:40/186 - (21%)
Similarity:66/186 - (35%) Gaps:37/186 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 ILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPDF--HNSG 134
            ||..||.:|     ||:  .|....|..:.|...||..|......|:..|.     |.:  ...|
Mouse    81 ILDYHNQVR-----GKV--FPPAANMEYMVWDENLAKSAEAWAATCIWDHG-----PSYLLRFLG 133

  Fly   135 QNLALVNITLLPEDGNHTDECLVKESIGGWWNQ----SINITKEQLQRFPKGKLGDSIRNFAVMA 195
            |||::       ..|.:..   :.:.:..|:::    :....::...|.|....|....::..|.
Mouse   134 QNLSV-------RTGRYRS---ILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMV 188

  Fly   196 RDNNTHVGCAA-----LRFEKPAGHPLFLLACNYA--SNYVPDWPIYKEKAIGCQS 244
            ...:..:|||.     :............|.||||  .|::.:.| || ..:.|.|
Mouse   189 WATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAP-YK-VGVPCSS 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 32/163 (20%)
Pi15NP_444421.2 SCP_euk 80..223 CDD:240180 32/163 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841281
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.