powered by:
Protein Alignment CG6628 and Crispld1
DIOPT Version :9
Sequence 1: | NP_648386.1 |
Gene: | CG6628 / 39183 |
FlyBaseID: | FBgn0036072 |
Length: | 277 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001343480.1 |
Gene: | Crispld1 / 83691 |
MGIID: | 1934666 |
Length: | 500 |
Species: | Mus musculus |
Alignment Length: | 66 |
Identity: | 19/66 - (28%) |
Similarity: | 25/66 - (37%) |
Gaps: | 10/66 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 72 ILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPDFHNSGQN 136
||..||.||:.: .|....|..:.|..||...|....:.|:.:|......|.. |||
Mouse 65 ILDLHNKLRSQV-------YPTASNMEYMTWDVELERSAESWAEMCLWEHGPASLLPSI---GQN 119
Fly 137 L 137
|
Mouse 120 L 120
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C167841239 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR10334 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.850 |
|
Return to query results.
Submit another query.