DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and Crispld1

DIOPT Version :10

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_113579.2 Gene:Crispld1 / 83691 MGIID:1934666 Length:500 Species:Mus musculus


Alignment Length:66 Identity:19/66 - (28%)
Similarity:25/66 - (37%) Gaps:10/66 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 ILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPDFHNSGQN 136
            ||..||.||:.:       .|....|..:.|..||...|....:.|:.:|......|..   |||
Mouse    65 ILDLHNKLRSQV-------YPTASNMEYMTWDVELERSAESWAEMCLWEHGPASLLPSI---GQN 119

  Fly   137 L 137
            |
Mouse   120 L 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 CAP_euk 69..225 CDD:349399 19/66 (29%)
Crispld1NP_113579.2 CAP_CRISPLD1 62..207 CDD:349407 19/66 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..281
LCCL 291..375 CDD:128866
LCCL 394..491 CDD:427521
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.