DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and CRISPLD1

DIOPT Version :10

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_113649.1 Gene:CRISPLD1 / 83690 HGNCID:18206 Length:500 Species:Homo sapiens


Alignment Length:245 Identity:48/245 - (19%)
Similarity:71/245 - (28%) Gaps:95/245 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 ILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPDFHNSGQN 136
            ||..||.||:.:       .|....|..:.|..||...|....:.|:.:|...            
Human    65 ILDLHNKLRSQV-------YPTASNMEYMTWDVELERSAESWAESCLWEHGPA------------ 110

  Fly   137 LALVNITLLPEDGNHTDECLVKESIGGWWNQSINITKEQLQRFPKGKLGDSIRNFA--------- 192
                  :|||..|         :::|..|.      :.:...|......|.:::|:         
Human   111 ------SLLPSIG---------QNLGAHWG------RYRPPTFHVQSWYDEVKDFSYPYEHECNP 154

  Fly   193 -----------------VMARDNNTHVGCAA-----LRFEKPAGHPLFLLACNYA--SNYVPDWP 233
                             |.|..|  .:|||.     :............|.|||:  .|:....|
Human   155 YCPFRCSGPVCTHYTQVVWATSN--RIGCAINLCHNMNIWGQIWPKAVYLVCNYSPKGNWWGHAP 217

  Fly   234 IYKEK----------AIGC------QSGSDLKYPSLCKAGEEYQDLIGQQ 267
             ||..          ..||      :.|||..||   ...||..::..||
Human   218 -YKHGRPCSACPPSFGGGCRENLCYKEGSDRYYP---PREEETNEIERQQ 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 CAP_euk 69..225 CDD:349399 32/183 (17%)
CRISPLD1NP_113649.1 CAP_CRISPLD1 62..207 CDD:349407 32/183 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..281 4/10 (40%)
LCCL 291..375 CDD:128866
LCCL 394..491 CDD:427521
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.