DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and AT5G02730

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_195893.1 Gene:AT5G02730 / 831820 AraportID:AT5G02730 Length:205 Species:Arabidopsis thaliana


Alignment Length:236 Identity:51/236 - (21%)
Similarity:85/236 - (36%) Gaps:60/236 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTELVVALMLFGFLQVAFSQDNATAPPTDYCQSGLCPSLKKHIA-CKNKGELGKQCSPDAHLVN 64
            :|:.|::.|::|          :...|.|....|   |..|...| ..|:|...||.:       
plant    14 ISSVLLLLLLIF----------SGEFPSTAGTSS---PDTKAAAARATNRGRRNKQSA------- 58

  Fly    65 LTGLQDLILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPD 129
                 :.:|. |||.|  :|||          .:.|:|...||..|:...||   :...|..|..
plant    59 -----EFLLA-HNAAR--VASG----------ASNLRWDQGLARFASKWAKQ---RKSDCKMTHS 102

  Fly   130 FHNSGQNLALVNITLLPEDGNHTDECLVKESIGGWWNQSINITKEQLQRFPKGKLGDSIRNFAVM 194
            ....|:|:...         ..::....:..:..|.::|:|..:..    ...|.|....::..:
plant   103 GGPYGENIFRY---------QRSENWSPRRVVDKWMDESLNYDRVA----NTCKSGAMCGHYTQI 154

  Fly   195 ARDNNTHVGCAALRFEKPAGHPLFLLACNY--ASNYVPDWP 233
            .....|.||||..:.:...|   ||:.|.|  :.||..:.|
plant   155 VWRTTTAVGCARSKCDNNRG---FLVICEYSPSGNYEGESP 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 34/157 (22%)
AT5G02730NP_195893.1 SCP_PR-1_like 57..193 CDD:240181 37/180 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.