DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and AT4G25780

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_194308.1 Gene:AT4G25780 / 828683 AraportID:AT4G25780 Length:190 Species:Arabidopsis thaliana


Alignment Length:251 Identity:46/251 - (18%)
Similarity:75/251 - (29%) Gaps:80/251 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTELVVALMLFGFLQVAFSQDNATAPPTDYCQSGLCPSLKKHIACKNKGELGKQCSPDAHLVNL 65
            ||:..:..::|.|.|.|..|.....:..|.....|     :....|||   |...|..|:     
plant     1 MSSSYLRVILLLGALNVVVSLSITNSLITKSATLG-----QVFRICKN---LCPGCDHDS----- 52

  Fly    66 TGLQDLILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQ----CVLQHDSCHN 126
              ||  .|..||.:|.......:|            |...|.:.|.....|    |.|:|...:.
plant    53 --LQ--FLFRHNLVRAARFEPPLI------------WDRRLQNYAQGWANQRRGDCALRHSVSNG 101

  Fly   127 TPDFHNSGQNLALVNITLLPEDGNHTDECLVKESIGGWWNQSIN----------ITKEQLQRFPK 181
              :| |.|:|:                          :|....|          .::::...:..
plant   102 --EF-NLGENI--------------------------YWGYGANWSPADAVVAWASEKRFYHYGS 137

  Fly   182 G--KLGDSIRNFAVMARDNNTHVGCAALRFEKPAGHPLFLLACNY--ASNYVPDWP 233
            .  ..|....::..:...:...||||.:..:...    ..:.|||  ..||:...|
plant   138 NTCDAGQMCGHYTQIVWKSTRRVGCARVVCDNGG----IFMTCNYDPPGNYIGQKP 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 27/173 (16%)
AT4G25780NP_194308.1 CAP_PR-1 54..190 CDD:349400 30/183 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.