powered by:
Protein Alignment CG6628 and AT4G07820
DIOPT Version :9
Sequence 1: | NP_648386.1 |
Gene: | CG6628 / 39183 |
FlyBaseID: | FBgn0036072 |
Length: | 277 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_192524.1 |
Gene: | AT4G07820 / 826263 |
AraportID: | AT4G07820 |
Length: | 160 |
Species: | Arabidopsis thaliana |
Alignment Length: | 42 |
Identity: | 9/42 - (21%) |
Similarity: | 17/42 - (40%) |
Gaps: | 4/42 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 183 KLGDSIRNFAVMARDNNTHVGCAALRFEKPAGHPLFLLACNY 224
:.|.|...:..:....:..:|||.::..... ||..|:|
plant 112 RAGKSCDGYKQVLFRKSVFLGCAKVKCNNGG----FLAICSY 149
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.