DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and AT3G19690

DIOPT Version :10

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_188603.1 Gene:AT3G19690 / 821506 AraportID:AT3G19690 Length:161 Species:Arabidopsis thaliana


Alignment Length:176 Identity:36/176 - (20%)
Similarity:57/176 - (32%) Gaps:50/176 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LQDLILGEHNALRNVLASGKIINLPKPDRMATLQWHSEL----ADLATLNVKQCVLQHDSCHNTP 128
            ||...|..||..||.:.            :..|.|..|:    |..|...:..|.|.|.   |.|
plant    25 LQQQFLEAHNEARNEVG------------LDPLVWDDEVAAYAASYANQRINDCALVHS---NGP 74

  Fly   129 DFHNSGQNLALVNITLLPEDGNHTDECLVKESIGGWWNQSINITKEQLQRFPKGKLGD----SIR 189
                .|:|:|:.:..:..||.            ...|     |.::|...:......|    :..
plant    75 ----FGENIAMSSGEMSAEDA------------AEMW-----INEKQYYDYDSNTCNDPNGGTCL 118

  Fly   190 NFAVMARDNNTHVGCAALRFEKPAGHPLFLLACNY--ASNYVPDWP 233
            ::..:...|...:|||.:......    ..:.|||  ..||:.:.|
plant   119 HYTQVVWKNTVRLGCAKVVCNSGG----TFITCNYDPPGNYIGEKP 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 CAP_euk 69..225 CDD:349399 32/165 (19%)
AT3G19690NP_188603.1 CAP_PR-1 26..161 CDD:349400 35/175 (20%)

Return to query results.
Submit another query.