DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and AT3G09590

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_187570.1 Gene:AT3G09590 / 820116 AraportID:AT3G09590 Length:186 Species:Arabidopsis thaliana


Alignment Length:188 Identity:44/188 - (23%)
Similarity:64/188 - (34%) Gaps:45/188 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PD-----AHLVNLTGLQDL---ILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNV 114
            ||     |.|||......|   .|..||..|  ::||          :.||.|..:||..|....
plant    31 PDAVNTAARLVNRARRAKLSREFLQAHNDAR--VSSG----------VPTLGWDRDLARFADKWA 83

  Fly   115 KQCVLQHDSCHNTPDFHNSGQNL--ALVNITLLPEDGNHTDECLVKESIGGWWNQSINITKEQLQ 177
            ||........|:...:   |:|:  .....|..||           :.:..|:.:..|...:...
plant    84 KQRKSDCSMIHSGGPY---GENIFWHRRKKTWSPE-----------KVVTRWFEERFNYDVKTNT 134

  Fly   178 RFPKGKLGDSIRNFAVMARDNNTHVGCAALRFEKPAGHPLFLLACNY--ASNYVPDWP 233
            ..|    |....::..|.....|.||||.::.....|   :|:.|.|  ..||..:.|
plant   135 CAP----GKMCGHYTQMVWRETTAVGCARVKCHNGRG---YLVVCEYDPRGNYEGERP 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 35/162 (22%)
AT3G09590NP_187570.1 CAP_PR-1 50..186 CDD:349400 37/169 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.