DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and PR1

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_179068.1 Gene:PR1 / 815949 AraportID:AT2G14610 Length:161 Species:Arabidopsis thaliana


Alignment Length:174 Identity:35/174 - (20%)
Similarity:53/174 - (30%) Gaps:66/174 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 HNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQ----CVLQHDSCHNTPDFHNSGQN 136
            ||..|..:..|            .:||...:|..|....:|    |.|.|..       ...|:|
plant    37 HNQARGAVGVG------------PMQWDERVAAYARSYAEQLRGNCRLIHSG-------GPYGEN 82

  Fly   137 LA----------LVNITLLPEDGNHTDECLVKESIGGWWNQSINITKEQLQRFPKGKLGDSIRNF 191
            ||          .||: .:.|..|:.........:.|.:.|                        
plant    83 LAWGSGDLSGVSAVNM-WVSEKANYNYAANTCNGVCGHYTQ------------------------ 122

  Fly   192 AVMARDNNTHVGCAALRFEKPAGHPLFLLACNY--ASNYVPDWP 233
             |:.| .:..:|||.:|.....    .:::|||  ..|||.:.|
plant   123 -VVWR-KSVRLGCAKVRCNNGG----TIISCNYDPRGNYVNEKP 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 31/164 (19%)
PR1NP_179068.1 SCP_PR-1_like 30..161 CDD:240181 35/174 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.