DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and PRB1

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_179064.1 Gene:PRB1 / 815945 AraportID:AT2G14580 Length:161 Species:Arabidopsis thaliana


Alignment Length:174 Identity:37/174 - (21%)
Similarity:55/174 - (31%) Gaps:53/174 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 QDLILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQ----CVLQHDSCHNTPD 129
            ||.: ..||..|:.:..|            .:||...||..|.....|    |.|.|.......:
plant    31 QDYV-NAHNQARSQIGVG------------PMQWDEGLAAYARNYANQLKGDCRLVHSRGPYGEN 82

  Fly   130 FHNSGQNL---ALVNITLLPEDGNHTDECLVKESIGGWWNQSINITKEQLQRFPKGKLGDSIRNF 191
            ...||.:|   |.||:                     |.|:..|...:  .....|..|    ::
plant    83 LAKSGGDLSGVAAVNL---------------------WVNEKANYNYD--TNTCNGVCG----HY 120

  Fly   192 AVMARDNNTHVGCAALRFEKPAGHPLFLLACNY--ASNYVPDWP 233
            ..:...|:..:|||.:|.....    .:::|||  ..||....|
plant   121 TQVVWRNSVRLGCAKVRCNNGG----TIISCNYDPPGNYANQKP 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 34/164 (21%)
PRB1NP_179064.1 CAP_PR-1 30..161 CDD:349400 37/174 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.