DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and Crisp4

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001333976.1 Gene:Crisp4 / 78081 MGIID:1925331 Length:293 Species:Mus musculus


Alignment Length:287 Identity:62/287 - (21%)
Similarity:95/287 - (33%) Gaps:92/287 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTELVVALMLFGFLQVAFSQDNATAPPTDYCQSGLCPSLKKHIACKNKGELGKQCSPDAHLVNL 65
            |:.:.::.|.:..|:.|      .|..|           ||...|..||.....|..|...:|| 
Mouse    44 MAVKFILLLFVAAFVPV------VTIRP-----------LKLDRALYNKLITESQTEPQEEIVN- 90

  Fly    66 TGLQDLILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQC-VLQHDSCHNTPD 129
                     .|||.|..::       |....|..:.|.|..|:.|.:..:.| ....||......
Mouse    91 ---------THNAFRRKVS-------PPARNMLKVSWSSAAAENARILARYCDKSDSDSLERRLP 139

  Fly   130 FHNSGQNLALVNITLLPEDGNHTDECLVKESIGGWWNQSINITKEQLQRFPKGK---LGDSIR-- 189
            ....|:|:.:                   |.....|::.|.|...:.:.|..|:   ..|.|.  
Mouse   140 NTFCGENMLM-------------------EHYPSSWSKVIEIWFNESKYFKYGEWPSTDDDIETD 185

  Fly   190 NFAVMARDNNTHVGC--AALRFEKPAGHPLFLLACNYA--SNY-----VPDWPIYKEKAIGCQSG 245
            ::..|...:...|||  ||.|.:|.|   .:|..|:|.  .|:     :|    |||       |
Mouse   186 HYTQMVWASTYLVGCDVAACRRQKAA---TYLYVCHYCHEGNHQDTLNMP----YKE-------G 236

  Fly   246 SDL-KYPSLCKAG---------EEYQD 262
            |.. ..|:.|:.|         :||.:
Mouse   237 SPCDDCPNNCEDGLCTNPCIYYDEYNN 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 34/163 (21%)
Crisp4NP_001333976.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841344
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.