DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and Pi16

DIOPT Version :10

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_076223.3 Gene:Pi16 / 74116 MGIID:1921366 Length:498 Species:Mus musculus


Alignment Length:167 Identity:36/167 - (21%)
Similarity:56/167 - (33%) Gaps:59/167 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 HNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPDFHNSGQNLALV 140
            ||..|..::       |....|..::|..|||..|....::||..|:.     :....|:||..:
Mouse    42 HNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGHNK-----ERGRRGENLFAI 94

  Fly   141 NITLLPEDGNHTDECL-VKESIGGWWNQSINITKEQLQRFPKGKLGDSIRNFAVMARDNN----- 199
                       |||.: |..::|.|        .|:.:.:          ||:....|.|     
Mouse    95 -----------TDEGMDVPLAVGNW--------HEEHEYY----------NFSTATCDPNQMCGH 130

  Fly   200 ---------THVGCAALRFEKPAG---HPLFLLACNY 224
                     ..:||.:...|...|   ..:.||.|||
Mouse   131 YTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNY 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 CAP_euk 69..225 CDD:349399 36/167 (22%)
Pi16NP_076223.3 CAP_PI16_HrTT-1 35..168 CDD:349405 36/167 (22%)
DUF5585 <183..458 CDD:465521
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..277
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 317..407
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 419..467
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.