DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and Glipr1

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_006514280.1 Gene:Glipr1 / 73690 MGIID:1920940 Length:270 Species:Mus musculus


Alignment Length:187 Identity:45/187 - (24%)
Similarity:74/187 - (39%) Gaps:40/187 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 HNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHD-SCHNT--PDFHNSGQNL 137
            ||.||:.::       |....|..:.|..:||.:|....|.|..:|: ..|:.  |:|...|:|:
Mouse    41 HNQLRSKVS-------PPARNMLYMSWDPKLAQIAKAWTKSCEFKHNPQLHSRIHPNFTALGENI 98

  Fly   138 ALVNITLLPEDGNHTDECLVKESIGGWWNQSINITKEQLQR--FPKGKLGDSIRNFAVMARDNNT 200
            .|.::::..          |..:|..|:        |:::.  |...|......::..:...::.
Mouse    99 WLGSLSIFS----------VSSAISAWY--------EEIKHYDFSTRKCRHVCGHYTQVVWADSY 145

  Fly   201 HVGCAALRFEKPAGHPLFLLACNY--ASNYVPDWPIYKEKAIGCQSGSDLK-YPSLC 254
            .:|||.......|.     ..|:|  |.|| |.|| ||:.|.......|.| ..|||
Mouse   146 KLGCAVQLCPNGAN-----FICDYGPAGNY-PTWP-YKQGATCSDCPKDDKCLNSLC 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 31/155 (20%)
Glipr1XP_006514280.1 CAP_GLIPR1-like 32..168 CDD:349404 31/156 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841323
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.