DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and CRISP2

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_005249406.1 Gene:CRISP2 / 7180 HGNCID:12024 Length:278 Species:Homo sapiens


Alignment Length:289 Identity:50/289 - (17%)
Similarity:83/289 - (28%) Gaps:99/289 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PTDYCQSGLCPSLKKHIACKNKGELGKQCSPDAHLVNLTGLQDLILGEHNALRNVLASGKIINLP 92
            |..:..:.|.|||...         ||..:..|.|.....:|..|:.:||.||..::       |
Human     5 PVLFLVTVLLPSLPAE---------GKDPAFTALLTTQLQVQREIVNKHNELRKAVS-------P 53

  Fly    93 KPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPDFHNSGQNLALVNITLLPEDGNHTDECLV 157
            ....|..::|..|:...|.....:|.|||....:.......|:||.:           .:|....
Human    54 PASNMLKMEWSREVTTNAQRWANKCTLQHSDPEDRKTSTRCGENLYM-----------SSDPTSW 107

  Fly   158 KESIGGWWNQSINITKEQLQRFPKGKLGDSIRNFAVMARDNNTHVGCA--------ALRFEKPAG 214
            ..:|..|:::.::.......:.|...:|    ::..:...:...|||.        :|::     
Human   108 SSAIQSWYDEILDFVYGVGPKSPNAVVG----HYTQLVWYSTYQVGCGIAYCPNQDSLKY----- 163

  Fly   215 HPLFLLACNYASNYVPDWPIYKEK----------------------------------------- 238
                    .|...|.|....|..|                                         
Human   164 --------YYVCQYCPAMKTYLNKREGINVWKCFLRLRHFQLLRGEQLLTFSGNNMNRKNTPYQQ 220

  Fly   239 ---AIGCQSGSDLKYPSLCKAGEEYQDLI 264
               ..||....|   ..||....:||||:
Human   221 GTPCAGCPDDCD---KGLCTNSCQYQDLL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 27/163 (17%)
CRISP2XP_005249406.1 SCP_CRISP 35..172 CDD:240183 29/171 (17%)
Crisp 224..278 CDD:285731 9/26 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151288
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.