DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and Glipr1l2

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_080499.1 Gene:Glipr1l2 / 67537 MGIID:1914787 Length:332 Species:Mus musculus


Alignment Length:217 Identity:42/217 - (19%)
Similarity:78/217 - (35%) Gaps:49/217 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQH----DSCHNT-PDFHN 132
            :|.||.||..:       .|....:..:.|...|:..|....|:|:...    |..|.: |.|..
Mouse    55 VGLHNELRGTV-------FPPGVNLRFMTWDVALSRTARAWGKKCMYSRNTHLDKLHESHPVFTE 112

  Fly   133 SGQNLALVNITLLPEDGNHTDECLVKESIGGWWNQS-----INITKEQLQRFPKGKLGDSIRNFA 192
            .|:|:.:          ...::..|..:|..|..:.     :|.|..:.|         :..::.
Mouse   113 IGENMWV----------GPVEDFTVTTAIRSWHEERKSYSYLNDTCVEDQ---------NCSHYI 158

  Fly   193 VMARDNNTHVGCAALRFEKPAGHPLFLLACNYASNYVPDWPIYKEKAIGCQSGSDLKYPSLCKAG 257
            .:..|::..||||.....:..|   |..|..:..||.|...:.:..   .|:|   ::.|.|..|
Mouse   159 QLVWDSSYKVGCAVTSCARAGG---FTHAALFICNYAPGGTLTRRP---YQAG---QFCSRCGPG 214

  Fly   258 EEYQDLIGQQGSKGK----RFW 275
            ::..|.:.....:.:    :||
Mouse   215 DQCTDYLCSNTVRDEATYYQFW 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 31/161 (19%)
Glipr1l2NP_080499.1 SCP 49..194 CDD:294090 33/167 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..332
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841428
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.