DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and crispl

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001025526.1 Gene:crispl / 594930 XenbaseID:XB-GENE-5768874 Length:314 Species:Xenopus tropicalis


Alignment Length:213 Identity:56/213 - (26%)
Similarity:77/213 - (36%) Gaps:64/213 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 ILGEHNALRNVLASGKIINL-PKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPDFHNSGQ 135
            ||..||.||.        |. |.|..|..:.|    :|||   .|......:||   ..:|    
 Frog   111 ILNVHNELRR--------NANPPPSNMLKMVW----SDLA---AKSAAKWANSC---KQYH---- 153

  Fly   136 NLALVNITLLPE---DGNHTDECLVKESIGGWWNQSINITKEQLQRFPKGK----LGDSIRNFAV 193
                   :|.||   .|....|.|...|....|...|.....:::.|..||    :|..|.:|..
 Frog   154 -------SLKPERTIPGFSCGENLFMASYKASWEDVIRAFYSEIEDFLYGKGAKEVGLQILHFTQ 211

  Fly   194 MARDNNTHVGCAALRFEKP-AGHPL-FLLACNY--ASNY----VPDWPIYK------EKAIGCQS 244
            :...::..|||||.  :.| ..|.| |...|:|  |.||    :|    ||      :....|::
 Frog   212 VMWFSSWLVGCAAA--QCPITDHSLEFYFVCHYAPAGNYGNVGIP----YKTGKPCEDCKSSCEN 270

  Fly   245 GSDLKYPSLCKAGEEYQD 262
            |       ||..|..:|:
 Frog   271 G-------LCTNGCNFQN 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 44/164 (27%)
crisplNP_001025526.1 CAP_CRISP 106..245 CDD:349402 44/164 (27%)
Crisp 261..314 CDD:369954 6/28 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.