DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and r3hdml

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001373427.1 Gene:r3hdml / 561976 ZFINID:ZDB-GENE-090313-275 Length:252 Species:Danio rerio


Alignment Length:207 Identity:47/207 - (22%)
Similarity:80/207 - (38%) Gaps:50/207 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 NLTGLQDLILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTP 128
            ::|.|.|.    ||.:|:.:       .|....|..:.|...||..|.....||:.:|...|   
Zfish    65 DMTALLDY----HNRVRSQV-------FPPAANMEYMVWDERLAKSAEFWASQCIWEHGPHH--- 115

  Fly   129 DFHNSGQNLALVNITLLPEDGNHTDECLVKESIGGWWNQSINITKEQLQRFPKGKLGDSIRNFAV 193
            ...:.||||::::       |.:..   :.:.:..|:::..:.:      :|....|....::..
Zfish   116 FLQHIGQNLSIIS-------GRYKS---IIDLVKSWYDERHSFS------YPSRCSGSVCTHYTQ 164

  Fly   194 MARDNNTHVGCAALRFEKPAGHPLF--------LLACNYA--SNYVPDWPIYKEKAIG--CQSGS 246
            |....:..:|||   .:|.:...:|        ||.||||  .|:|.:.| ||   ||  | |..
Zfish   165 MVWAASNKIGCA---IKKCSDIFVFGSMWKQATLLVCNYAIKGNWVGEAP-YK---IGRPC-SAC 221

  Fly   247 DLKYPSLCKAGE 258
            ...|...|...:
Zfish   222 PSSYGGSCNKNQ 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 32/163 (20%)
r3hdmlNP_001373427.1 CAP_R3HDML 66..201 CDD:349409 34/167 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585757
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.