DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and pi15b

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_684600.2 Gene:pi15b / 556658 ZFINID:ZDB-GENE-070912-590 Length:257 Species:Danio rerio


Alignment Length:186 Identity:38/186 - (20%)
Similarity:66/186 - (35%) Gaps:57/186 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 ILGEHNALR-NVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPDF--HNS 133
            ||..||.:| ||        .|....|..:.|...||..|......|:.:|.     |.:  ...
Zfish    69 ILDYHNKVRANV--------FPPAANMEYMLWDDGLARSAEAWAATCIWEHG-----PPYLLRYL 120

  Fly   134 GQNLALVNITLLPEDGNHTDECLVKESIGGWWNQSINITKEQLQRFPKG--------KLGDSIRN 190
            ||||::       ..||:..   :.:.:..|:::    .::.:..:|:.        ..|....:
Zfish   121 GQNLSV-------RTGNYRS---ILQLVKPWYDE----VRDYMFPYPRDCNPHCPMRCYGPMCTH 171

  Fly   191 FAVMARDNNTHVGCA-----------ALRFEKPAGHPLFLLACNYA--SNYVPDWP 233
            :..|...::..||||           |:..|..      .|.|||:  .|::.:.|
Zfish   172 YTQMVWASSNRVGCAIQTCFNMVVWGAVWREAT------YLVCNYSPKGNWIGEAP 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 35/174 (20%)
pi15bXP_684600.2 SCP_euk 68..211 CDD:240180 35/174 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585778
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.000

Return to query results.
Submit another query.