DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and Glipr1l3

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001360960.1 Gene:Glipr1l3 / 544736 MGIID:3620621 Length:236 Species:Mus musculus


Alignment Length:194 Identity:47/194 - (24%)
Similarity:73/194 - (37%) Gaps:34/194 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 DLILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTP-----D 129
            |..|..||.||      :.:..|..| |..:.|..:||.||....::|.|.|:.|.:..     |
Mouse    43 DAFLNIHNELR------RKVQPPAAD-MNQVIWDQKLAKLAKAWTRECKLGHNPCTSKQYGCLLD 100

  Fly   130 FHNSGQNLALVNITLLPEDGNHTDECLVKESIGGWWNQSINITKEQLQRFPKGKLGDSIRNFAVM 194
            :...|:|:.|..|...|||           .:..|:|::.:      ..|.........||:..:
Mouse   101 YDFIGENIYLGEIETQPED-----------VVNNWYNENTD------YNFVDNTCSKICRNYTQL 148

  Fly   195 ARDNNTHVGCAALRFEKPAGHPLFLLACNYA--SNYVPDWPIYKEKAIGCQSGSDLKYP-SLCK 255
            .......:|||.........:...|..|||:  .|:: |:..|: |...|......|.. |||:
Mouse   149 VWAKTFKIGCAVSNCPNLTRYSAGLFVCNYSPTGNFL-DFRPYR-KGDPCSMCGQRKCENSLCR 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 37/159 (23%)
Glipr1l3NP_001360960.1 CAP 40..182 CDD:381818 38/162 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841403
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.