DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and PI15

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001311332.1 Gene:PI15 / 51050 HGNCID:8946 Length:258 Species:Homo sapiens


Alignment Length:258 Identity:54/258 - (20%)
Similarity:87/258 - (33%) Gaps:52/258 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VVALMLFGFL----QVAFSQDNATAPPTDYCQSGLCPSLKKHIACKNKGELGKQCSPDAHLVNLT 66
            |.:.:||..|    .|.......::|||:....         |....|.:|.....|.|......
Human     7 VSSALLFSLLCEASTVVLLNSTDSSPPTNNFTD---------IEAALKAQLDSADIPKARRKRYI 62

  Fly    67 GLQDL--ILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPD 129
            ...|:  ||..||.:|     ||:  .|....|..:.|...||..|......|:..|.     |.
Human    63 SQNDMIAILDYHNQVR-----GKV--FPPAANMEYMVWDENLAKSAEAWAATCIWDHG-----PS 115

  Fly   130 F--HNSGQNLALVNITLLPEDGNHTDECLVKESIGGWWNQ----SINITKEQLQRFPKGKLGDSI 188
            :  ...||||::       ..|.:..   :.:.:..|:::    :....::...|.|....|...
Human   116 YLLRFLGQNLSV-------RTGRYRS---ILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMC 170

  Fly   189 RNFAVMARDNNTHVGCAA-----LRFEKPAGHPLFLLACNYA--SNYVPDWPIYKEKAIGCQS 244
            .::..|....:..:|||.     :............|.||||  .|::.:.| || ..:.|.|
Human   171 THYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAP-YK-VGVPCSS 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 33/168 (20%)
PI15NP_001311332.1 CAP_PI15 67..212 CDD:349408 32/166 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151204
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5261
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.