DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and Glipr1l1

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_002729836.2 Gene:Glipr1l1 / 503139 RGDID:1563000 Length:235 Species:Rattus norvegicus


Alignment Length:205 Identity:49/205 - (23%)
Similarity:71/205 - (34%) Gaps:34/205 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PDAHLVNLTGLQDLILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHD 122
            |....:|....::..|..||..|..:.       |....|..|.|...||.||....::|...|:
  Rat    31 PRVPTINDPEFKNGFLNSHNEARRKVQ-------PPASNMNQLSWDKSLAKLAKSWTRECKFSHN 88

  Fly   123 SCHN-----TPDFHNSGQNLALVNITLLPEDGNHTDECLVKESIGGWWNQSINITKEQLQRFPKG 182
            .|.:     |.|:...|:|:.|..|...|||           .:..|:|:    ||:  ..|...
  Rat    89 PCTSKRHGCTKDYDYIGENIYLGKIDARPED-----------VVFSWYNE----TKD--YNFDDN 136

  Fly   183 KLGDSIRNFAVMARDNNTHVGCAALRFEKPAGHPLFLLACNY--ASNYVPDWPIYK-EKAIGCQS 244
            ....:..::..:.......:|||........|:...|..|||  |.|:....|..| |....|  
  Rat   137 TCTKTCGHYTQVVWAKTLKIGCAISNCPHLTGYSAGLFVCNYVPAGNFQGSKPYIKGEPCSMC-- 199

  Fly   245 GSDLKYPSLC 254
            |......|||
  Rat   200 GEKECVNSLC 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 37/162 (23%)
Glipr1l1XP_002729836.2 SCP 40..181 CDD:294090 37/164 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344783
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.