DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and CLEC18B

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001011880.2 Gene:CLEC18B / 497190 HGNCID:33849 Length:455 Species:Homo sapiens


Alignment Length:194 Identity:44/194 - (22%)
Similarity:68/194 - (35%) Gaps:42/194 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPDFHNSGQ 135
            |:|..||.||:      .:..|..| |..|.|...||.||......|.:.      ||...:...
Human    50 LLLSLHNRLRS------WVQPPAAD-MRRLDWSDSLAQLAQARAALCGIP------TPSLASGLW 101

  Fly   136 NLALV--NITLLPEDGNHTDECLVKESIGGWWNQSINITKEQLQRFPKGKLGDSIRN-----FAV 193
            ....|  |:.|||     .......|.:..|:.:.        ||:... .|:..||     :..
Human   102 RTLQVGWNMQLLP-----AGLASFVEVVSLWFAEG--------QRYSHA-AGECARNATCTHYTQ 152

  Fly   194 MARDNNTHVGCAALRFEKPAGH-PLFLLACNYASNYVPDWPIYKEKAIGCQSGSDLKYPSLCKA 256
            :....::.:||.  |....||. .:....|.|:..  .:|.:..:..|..:.|:   :.|||.|
Human   153 LVWATSSQLGCG--RHLCSAGQTAIEAFVCAYSPG--GNWEVNGKTIIPYKKGA---WCSLCTA 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 36/161 (22%)
CLEC18BNP_001011880.2 SCP_euk 50..183 CDD:240180 36/161 (22%)
CLECT 310..443 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151053
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.