DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and Ag5r

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001245671.1 Gene:Ag5r / 44631 FlyBaseID:FBgn0015010 Length:256 Species:Drosophila melanogaster


Alignment Length:257 Identity:94/257 - (36%)
Similarity:132/257 - (51%) Gaps:28/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LQVAFSQDNATAPPTDYCQSGLCPSLKKHIACKNKGELGKQCSPDAHLVNLTGLQ-DLILGEHNA 78
            |.:||    ..|..||||:.. |.| .|::.|.|.|.....|..||.|:.|:..: |.::...|.
  Fly    10 LSLAF----GIASATDYCKKS-CGS-TKNLGCDNNGAWASSCPSDATLLTLSSAEKDALVARTNE 68

  Fly    79 LRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPDFHNSGQNLAL---- 139
            .||.:|.|...||....||||::|:.|||.||:||||.|.::||.||||..|..||||||.    
  Fly    69 YRNHIAGGLNANLSAACRMATIKWNDELAYLASLNVKSCQMKHDGCHNTDAFDWSGQNLAWMGYY 133

  Fly   140 --VNITLLPEDGNHTDECLVKESIGGWWNQSINITKEQLQRFPKGKLGDSIRNFAVMARDNNTHV 202
              :|:|...|.|           :..|:::::...:..:..:|....|.:|.:|.|:..|.||.|
  Fly   134 NPLNVTHYLEWG-----------VDMWYDEAVYTKQAYIDAYPSNYNGPAIGHFTVLVADRNTEV 187

  Fly   203 GCAALRFE-KPAGHPLFLLACNYASNYVPDWPIY---KEKAIGCQSGSDLKYPSLCKAGEEY 260
            ||||..:. ....:..||||||||:..|....:|   .:.|..|.:|::.||..||.|.|||
  Fly   188 GCAAATYSVSGQSYKAFLLACNYAATNVLGIKMYSSCSKAASKCTTGTNPKYKYLCSAKEEY 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 60/163 (37%)
Ag5rNP_001245671.1 SCP_euk 59..211 CDD:240180 60/162 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440563
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.