DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and scpr-A

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster


Alignment Length:268 Identity:99/268 - (36%)
Similarity:138/268 - (51%) Gaps:20/268 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTELVVALMLFGFLQVAFSQDNATAPPTDYCQSGLCPSLKKHIACKNKGELGKQCSPDAHLVNL 65
            |:...|:.|:|...:        |.:...|||....|  |.||:||.|||...:.|..|...|.:
  Fly     1 MAFTKVLQLILLAVV--------AISSAVDYCALPTC--LDKHVACNNKGNFSENCPKDVREVKI 55

  Fly    66 TGLQDLILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPDF 130
            .....|||...|.|||.:|.|||..|||..|||.:.|..||:.||.||||.|....|.|.:|..|
  Fly    56 EPHHKLILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERF 120

  Fly   131 HNSGQNLALVNITLLPEDGNHTDECLVKESIGGWWNQSINITKEQLQRFPKGKLGDSIRNFAVMA 195
            ..:|||.||...:  ..:..:||..::||.|..|:.:..|.:.|.|..||:.....::..|.:..
  Fly   121 AYAGQNNALFQYS--GAETEYTDAEIIKEEIENWFAERSNASPEILASFPEELPNKAVTKFTIAV 183

  Fly   196 RDNNTHVGCAALRFEKP-AGHPLFLLACNYASNYVPDWPIYK--EKA-IGCQS--GSDLKYPSLC 254
            .:.||||||||:||.:. ..|  |:|.||:|::.:...|:|.  ||| .||::  |:...||:||
  Fly   184 AEKNTHVGCAAVRFSRDFYNH--FVLTCNFATSNIVGQPVYTPGEKATTGCKNRYGAAYDYPNLC 246

  Fly   255 KAGEEYQD 262
            .|.|.|.:
  Fly   247 YAKEIYDN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 63/156 (40%)
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 63/155 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440537
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.