DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and CG42564

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_649651.2 Gene:CG42564 / 40788 FlyBaseID:FBgn0260766 Length:500 Species:Drosophila melanogaster


Alignment Length:319 Identity:97/319 - (30%)
Similarity:140/319 - (43%) Gaps:64/319 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VVALMLFGFLQVAFSQDNATAPPT-----------------------------DYCQSGLCPSLK 41
            ::||::|........|..||..|:                             |||...||....
  Fly     1 MLALVVFLIASCLTIQTAATTTPSPAVTEAGHPSPGGSQGQEEPGNSSSTELPDYCDPSLCHKEL 65

  Fly    42 KHIACKNKGELGKQCSPDAHLVNLT-GLQDLILGEHNALRNVLASGKIINLPKPDRMATLQWHSE 105
            ||:||....||..:||.||.|:.:: .::..:|...|.||:.:|.|....|....||.||:|:.|
  Fly    66 KHVACNASIELHDKCSLDAELIVISPKVERFLLRRFNELRDSVAKGGFNGLSPASRMGTLKWNPE 130

  Fly   106 LADLATLNVKQCVLQHDSCHNTPDFHNSGQNLALVNIT-LLPEDGNHTDECLVKESIGGWWNQS- 168
            ||.||..||:.|||:||.|.||....|:||.:....|. .|||     .|.::::.||.|..:. 
  Fly   131 LAYLAEFNVRDCVLRHDECRNTKFTQNAGQTVGYRGIKGKLPE-----LEDILRDIIGVWLREKS 190

  Fly   169 ----INITK--EQLQRFPKGKLGDSIRNFAVMARDNNTHVGCAALRFEKPAGHPLFLLACNYASN 227
                :||.|  ||..:.||       .||..:..:|...||||.::..:......| .||||...
  Fly   191 RTSMVNIMKYVEQESQSPK-------YNFLQIVLENAESVGCAIVQQSRHGWIQTF-FACNYGHA 247

  Fly   228 YVPDWPIY---KEKAIGCQSGSDLKYPSLCKAGEEYQDLIGQQGSK----------GKR 273
            .|...|:|   |:.|..|::|::.||..||...|.|:.:..:.|:.          |||
  Fly   248 PVVGSPVYEPGKKAAESCKTGANPKYAHLCAESEVYEKVTPKAGNASSPEIKTRTLGKR 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 56/163 (34%)
CG42564NP_649651.2 SCP_euk 95..245 CDD:240180 56/162 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440579
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.