DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and glipr1b

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_005159058.1 Gene:glipr1b / 393547 ZFINID:ZDB-GENE-040426-1459 Length:255 Species:Danio rerio


Alignment Length:171 Identity:34/171 - (19%)
Similarity:57/171 - (33%) Gaps:42/171 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 WHSELADLATLNVKQCVLQHDSC---HNTPDFHNSGQNLALVNITLLPEDGNHTDECLVKESIGG 163
            |..|||..|....:.|...|...   ...|.|...|:|:.|         |:......|:.::..
Zfish    68 WDKELAKGARDRARHCKGSHYPSLGHFGHPLFGWMGENIWL---------GSPFSAFSVENAVHR 123

  Fly   164 WWNQSINITKEQLQRFPKGKLGDSIRNFAVMARDNNTHVGCA----ALRFEKPAGHP-LFLLACN 223
            |       :||...............::|.:....:..:|||    :...|..:.|| ..:..||
Zfish   124 W-------SKEGAYSVKNNNCSRLCGHYAQLMWSTSFKMGCAVNVCSKGIENFSTHPESTIFVCN 181

  Fly   224 YASN--------YVPDWPIYKEKAIGCQS-GSDLKYPSLCK 255
            |...        |:         |:||.. ||::...::|:
Zfish   182 YGDTGQVHGVTPYM---------AMGCSGCGSEICRDNVCR 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 26/130 (20%)
glipr1bXP_005159058.1 SCP 32..185 CDD:294090 27/132 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.