DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and CG3640

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster


Alignment Length:237 Identity:82/237 - (34%)
Similarity:121/237 - (51%) Gaps:17/237 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DYCQSGLCPSLKKHIACKNKGELGKQCSPDAHLVNLTG-LQDLILGEHNALRNVLASGKIINLPK 93
            ||||...||....|:||.|.|..|..|..:|.|:.|:. ||..|:.:.|..||.:|||.:.....
  Fly    25 DYCQEHWCPRSTDHVACNNNGTFGLDCGREARLIPLSNQLQAFIVHQVNFYRNQVASGGLSAFGP 89

  Fly    94 PDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPDFHNSGQNLALVNITLLPEDGNHTDECLVK 158
            ..|||:::|..|||.||.|..|:|.|..|.|.||..|.:.||....|..:.    |.|:|..|::
  Fly    90 ARRMASVRWDPELAQLAELAAKRCSLSGDGCRNTRRFKHVGQLTGHVIFSA----GKHSDLELLR 150

  Fly   159 ESIGGWWNQSINITKEQLQRFPKGKLGDSIRNFAVMARDNNTHVGCAALRFEKPAGHPLF---LL 220
            ..|..|:.|.:..:|:.....|    ..:|.:|..:.::::||:||..||   ...|.|:   .:
  Fly   151 HKISNWFGQYMRASKDLQAADP----SSNISSFRQLIQESSTHMGCGVLR---QRSHMLWHQQFI 208

  Fly   221 ACNYASNYVPDWPIYK--EKAIGCQSGSDLKYPSLCKAGEEY 260
            .||:|...:|...:|:  ..|.||:||.:.:||:||...|||
  Fly   209 VCNFARRNMPREQVYQVGVAATGCRSGRNPRYPNLCALQEEY 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 50/158 (32%)
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 50/158 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440599
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.