DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and CG43775

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster


Alignment Length:256 Identity:67/256 - (26%)
Similarity:113/256 - (44%) Gaps:37/256 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DYC--QSGLCP-SLKKHIACKNKGEL---GKQCSPDAHLVNLTGLQDLILGEHNALRNVLASGKI 88
            :||  ::.:|. :.:||..|: .|||   |.:....|.:.:...::...|...|..|::||.|::
  Fly    22 NYCNNRTHVCDLAQRKHFMCR-LGELKPYGGRAKYYASIPDTLKVRKDTLAVLNTFRDMLAGGEL 85

  Fly    89 -----INLPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPDFHNSGQNLALVNITLLPED 148
                 ...|...||..|||.||||.:|..:.......|..|.:|..|..:|:.||     |.|..
  Fly    86 DTAENKTFPSAKRMRALQWDSELAYMARTHAATVSFMHSECRSTLRFPLAGEVLA-----LSPPV 145

  Fly   149 GNH---TDECLVKESIGGWWNQSINITKEQ--LQRFPKGKLGDSIRNFAVMARDNNTHVGC---A 205
            |:.   |:  |::......:::...:...|  .:|| ..|...|:.:|:::..|..:.|||   .
  Fly   146 GHRLSLTE--LLRMVFAHIFDEYKTVQDPQSFARRF-DSKRDYSVGHFSIIVNDRVSRVGCGFAV 207

  Fly   206 ALRFEKPAGHPLF--LLACNYASNYVPDWPIYK--EKAIGC---QSGSDLKYPSLCK-AGE 258
            ....||. |...|  .|.|::....|....:||  :...||   ::.:.:||.:||: .||
  Fly   208 GSNCEKD-GKVGFCHFLTCHFDYTNVNGSYVYKTGKATTGCNDWKTIASIKYSNLCENTGE 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 45/170 (26%)
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 45/170 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440697
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.