DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and CG17974

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster


Alignment Length:273 Identity:90/273 - (32%)
Similarity:132/273 - (48%) Gaps:31/273 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTELVVALMLFGFLQVAFSQDNATAPPTDYCQSGLCPSLKKHIACKNKGELGKQCSPDAHLVNL 65
            ||:.|:...:.....|:..::|.:      :|...||.:..:||||:..|...::|.|||..|::
  Fly     1 MSSPLICLAIFQLIFQLILAKDYS------WCDPDLCGNGVRHIACRTTGNFHRRCQPDAVQVDV 59

  Fly    66 TGLQDLILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPDF 130
            :..:...|..||..||.||.||:.......||||:.|..||..|:.||.:.|.|.||.||||..:
  Fly    60 SRHKADFLHAHNKRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHDDCHNTYRY 124

  Fly   131 HNSGQNLAL--------VNITLLPEDGNHTDECLVKESIGGWWNQSINITKEQLQRFPKGKLGDS 187
            .||||||..        ||:|           .||:|.:|.|:|:...|....:..|....:.:.
  Fly   125 ANSGQNLCAVWRPRSPHVNVT-----------SLVEECLGLWFNEFDLIDSSFIDSFKVTPIFED 178

  Fly   188 IRNFAVMARDNNTHVGCAALRFEKPAGHP---LFLLACNYASNYVPDWPIYK--EKAIGCQSGSD 247
            ..:||.::.|.|..|||:.:||.:| .:|   ::...|||||.|....|:|:  ..|..|.:|..
  Fly   179 YGHFAELSVDKNFAVGCSIMRFTRP-DYPSVYIYNFICNYASLYALGAPVYETGRAASRCTTGKS 242

  Fly   248 LKYPSLCKAGEEY 260
            ..||.||...|.|
  Fly   243 HFYPGLCSTREVY 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 57/166 (34%)
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 57/166 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440561
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.