DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and CG9822

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster


Alignment Length:250 Identity:98/250 - (39%)
Similarity:134/250 - (53%) Gaps:25/250 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ATAPPTDYCQSGLCPSLKKHIACKNKGELGKQCSPDAHLVNLTGLQDLILGEHNALRNVLASGKI 88
            |::.|..:|...|||....||||.|.|:..:.|||||.:|:|...:.||:.|||..||.:|||.:
  Fly    19 ASSQPLSWCDPDLCPDNTVHIACNNDGKFHESCSPDATMVDLKPYRKLIVNEHNKRRNYIASGSL 83

  Fly    89 INLPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPDFHNSGQNLALV--------NITLL 145
            .......||||:.|..||..|||||:|.|.|:||.|||:..|.|.||||..|        |:|  
  Fly    84 PGYYPATRMATMVWDEELEYLATLNLKTCYLEHDDCHNSYRFRNLGQNLCGVDRRRNWDLNVT-- 146

  Fly   146 PEDGNHTDECLVKESIGGWWNQSINITKEQLQRFPKGKLGDSIRNFAVMARDNNTHVGCAALRFE 210
                     .||::|:|.|:.:...|....:..|...|..:...:|.....|.|||||||.:||.
  Fly   147 ---------NLVEQSMGLWFGEHKLIDSSYITDFKLTKDLEKYGHFVETVLDRNTHVGCAMMRFT 202

  Fly   211 KPAGHP---LFLLACNYASNYVPDWPIYK--EKAIGCQSGSDLKYPSLCKAGEEY 260
            .|. :|   ::..||||||.|....|:|.  :.|..|::||:.:||:||...|:|
  Fly   203 NPQ-YPFLYIYNTACNYASVYAIGVPVYNAGKPASECRTGSNPEYPALCSIKEQY 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 63/166 (38%)
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 63/166 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440560
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.