DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and R3hdml

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001102432.1 Gene:R3hdml / 366245 RGDID:1305296 Length:253 Species:Rattus norvegicus


Alignment Length:214 Identity:43/214 - (20%)
Similarity:73/214 - (34%) Gaps:66/214 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 KKHIACKNKGELGKQCSPDAHLVNLTGLQDLILGEHNALRNVLASGKIINLPKPDRMATLQWHSE 105
            |:||:.::                    .:.:|..||.:|..:.       |....|..:.|..:
  Rat    55 KRHISARD--------------------MNALLDYHNHIRASVH-------PPASNMEYMVWDEQ 92

  Fly   106 LADLATLNVKQCVLQHDSCHNTPDFHNSGQNLALVNITLLPEDGNHTDEC-LVKESIGGWWNQSI 169
            ||..|.....||:..|.....|   ...||||::       ..|.:.... |||.     |::  
  Rat    93 LARAAEAWATQCIWAHGPSQLT---KYVGQNLSV-------HSGRYRSVVDLVKS-----WSE-- 140

  Fly   170 NITKEQLQRFPKGK----------LGDSIRNFAVMARDNNTHVGCA-----ALRFEKPAGHPLFL 219
               :::...||..|          .|....::..|...:::.:|||     ::............
  Rat   141 ---EKRHYSFPAPKDCTPHCPWLCSGPVCSHYTQMVWASSSRLGCAIHTCSSINVWGSTWQQAVY 202

  Fly   220 LACNYA--SNYVPDWPIYK 236
            |.||||  .|::.:.| ||
  Rat   203 LVCNYAIKGNWIGEAP-YK 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 34/171 (20%)
R3hdmlNP_001102432.1 SCP 65..207 CDD:294090 33/168 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344657
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.