DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and CLEC18A

DIOPT Version :10

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_047290014.1 Gene:CLEC18A / 348174 HGNCID:30388 Length:476 Species:Homo sapiens


Alignment Length:196 Identity:45/196 - (22%)
Similarity:69/196 - (35%) Gaps:46/196 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPDFHNSGQ 135
            |:|..||.||:      .:..|..| |..|.|...||.||......|...      ||...:...
Human    50 LLLSLHNRLRS------WVQPPAAD-MRRLDWSDSLAQLAQARAALCGTP------TPSLASGLW 101

  Fly   136 NLALV--NITLLPEDGNHTDECLVK--ESIGGWWNQSINITKEQLQRFPKGKLGDSIRN-----F 191
            ....|  |:.|||..       ||.  |.:..|:.:.        ||:... .|:..||     :
Human   102 RTLQVGWNMQLLPAG-------LVSFVEVVSLWFAEG--------QRYSHA-AGECARNATCTHY 150

  Fly   192 AVMARDNNTHVGCAALRFEKPAGH-PLFLLACNYASNYVPDWPIYKEKAIGCQSGSDLKYPSLCK 255
            ..:....::.:||.  |....||. .:....|.|:..  .:|.:..:..:..:.|:   :.|||.
Human   151 TQLVWATSSQLGCG--RHLCSAGQAAIEAFVCAYSPR--GNWEVNGKTIVPYKKGA---WCSLCT 208

  Fly   256 A 256
            |
Human   209 A 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 CAP_euk 69..225 CDD:349399 38/163 (23%)
CLEC18AXP_047290014.1 CAP_euk 50..183 CDD:349399 38/163 (23%)
EGF_CA 230..261 CDD:238011
CLECT 310..434 CDD:153057
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.