DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and CG4270

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster


Alignment Length:153 Identity:28/153 - (18%)
Similarity:47/153 - (30%) Gaps:59/153 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 NALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHN-TPDFHNSGQNLAL- 139
            ||..|.||.               :|.:.|.|           |:...|. .|.:   |:|:.| 
  Fly    54 NAALNKLAQ---------------EWANHLRD-----------QNTMAHRPNPKY---GENIFLS 89

  Fly   140 --VNIT-LLPEDGNHTDECLVKESIGGWWNQSINITKEQLQRFPKGKLGDSIRNFAVMARDNNTH 201
              :::| .||.:               .|.:.||     ...|.|.:...:..:|..:...::..
  Fly    90 GGMDVTGDLPVE---------------MWYREIN-----SYDFNKAQFVPTAGHFTQLIWKSSVE 134

  Fly   202 VGCAALRFEKPAGHPLFLLACNY 224
            :|....|.....     .:.|||
  Fly   135 MGSGVARKADRT-----WVVCNY 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 28/153 (18%)
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 28/153 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455142
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.