DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and Pi15

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001100387.1 Gene:Pi15 / 301489 RGDID:1309577 Length:258 Species:Rattus norvegicus


Alignment Length:186 Identity:40/186 - (21%)
Similarity:66/186 - (35%) Gaps:37/186 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 ILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPDF--HNSG 134
            ||..||.:|     ||:  .|....|..:.|...||..|......|:..|.     |.:  ...|
  Rat    70 ILDYHNQVR-----GKV--FPPAANMEYMVWDENLAKSAEAWAATCIWDHG-----PSYLLRFLG 122

  Fly   135 QNLALVNITLLPEDGNHTDECLVKESIGGWWNQ----SINITKEQLQRFPKGKLGDSIRNFAVMA 195
            |||::       ..|.:..   :.:.:..|:::    :....::...|.|....|....::..|.
  Rat   123 QNLSV-------RTGRYRS---ILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMV 177

  Fly   196 RDNNTHVGCAA-----LRFEKPAGHPLFLLACNYA--SNYVPDWPIYKEKAIGCQS 244
            ...:..:|||.     :............|.||||  .|::.:.| || ..:.|.|
  Rat   178 WATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAP-YK-VGVPCSS 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 32/163 (20%)
Pi15NP_001100387.1 SCP_euk 69..212 CDD:240180 32/163 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344678
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.