DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and Glipr1

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001011987.1 Gene:Glipr1 / 299783 RGDID:1305978 Length:251 Species:Rattus norvegicus


Alignment Length:169 Identity:44/169 - (26%)
Similarity:69/169 - (40%) Gaps:35/169 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 HNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHD-SCHNT--PDFHNSGQNL 137
            ||..|:..       .|....|..:.|..:||.:|....:.||.||: ..|:.  |:|...|:|:
  Rat    41 HNHFRSKA-------YPPAGNMLYMSWDPKLAQIAKAWAQSCVFQHNPQLHSRIHPNFTGLGENI 98

  Fly   138 ALVNITLLPEDGNHTDECLVKESIGGWWNQSINITKEQLQRFPKGKLGDSIRNFAVMARDNNTHV 202
            .|.:::|..          |:.:|..|:.:|      |...|..||......::..:...::..:
  Rat    99 WLGSLSLFS----------VRAAILAWFEES------QYYDFSTGKCKKVCGHYTQIVWADSYKI 147

  Fly   203 GCAALRFEKPAGHPLFLLACNY--ASNYVPDWPIYKEKA 239
            |||.....:.|.     ..|||  |.|| |.|| ||:.|
  Rat   148 GCAVQLCPRGAN-----FICNYGPAGNY-PTWP-YKQGA 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 35/153 (23%)
Glipr1NP_001011987.1 CAP 32..168 CDD:412178 35/154 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344720
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.