DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6628 and Pi16

DIOPT Version :9

Sequence 1:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001163952.1 Gene:Pi16 / 294312 RGDID:1304760 Length:483 Species:Rattus norvegicus


Alignment Length:155 Identity:33/155 - (21%)
Similarity:56/155 - (36%) Gaps:35/155 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 HNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPDFHNSGQNLALV 140
            ||..|..::       |....|..::|..|||..|....::||..|:.     :....|:||..:
  Rat    46 HNHYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGHNK-----ERGRRGENLFAI 98

  Fly   141 NITLLPEDGNHTDECL-VKESIGGWW--NQSINITKEQLQRFPKGKLGDSIRNFAVMARDNNTHV 202
                       |||.: |..::|.|.  ::..|::......      |....::..:.......:
  Rat    99 -----------TDEGMDVPLAVGNWHEEHEYYNLSTATCDP------GQMCGHYTQVVWSKTERI 146

  Fly   203 GCAALRFEKPAG---HPLFLLACNY 224
            ||.:...|...|   ..:.||.|||
  Rat   147 GCGSHFCETLQGVEEANIHLLVCNY 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 33/155 (21%)
Pi16NP_001163952.1 SCP_HrTT-1 39..172 CDD:240186 33/155 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.